Difference between revisions of "Os05g0125000"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Sumoylation is a post-translational regulatory process in diverse cellular processes in eukaryotes, involving conjugation/deconjugation of small ubiquitin-like modifier (SUMO) proteins to other proteins thus modifying their function. The PIAS [protein inhibitor of activated signal transducers and activators of transcription (STAT)] and SAP (scaffold attachment factor A/B/acinus/PIAS)/MIZ (SIZ) proteins exhibit SUMO E3-ligase activity that facilitates the conjugation of SUMO proteins to target substrates. Here, we report the isolation and molecular characterization of Oryza sativa SIZ1 (OsSIZ1) and SIZ2 (OsSIZ2), rice homologs of Arabidopsis SIZ1. The rice SIZ proteins are localized to the nucleus and showed sumoylation activities in a tobacco system. Our analysis showed increased amounts of SUMO conjugates associated with environmental stresses such as high and low temperature, NaCl and abscisic acid (ABA) in rice plants. The expression of OsSIZ1 and OsSIZ2 in siz1-2 Arabidopsis plants partially complemented the morphological mutant phenotype and enhanced levels of SUMO conjugates under heat shock conditions. In addition, ABA-hypersensitivity of siz1-2 seed germination was partially suppressed by OsSIZ1 and OsSIZ2. The results suggest that rice SIZ1 and SIZ2 are able to functionally complement Arabidopsis SIZ1 in the SUMO conjugation pathway. Their effects on the Arabidopsis mutant suggest a function for these genes related to stress responses and stress adaptation[1].
 +
 
 +
OsSIZ1 Regulates the Vegetative Growth and Reproductive Development in Rice.Two homologous genes from rice (Oryza sativa) were isolated and designated as OsSIZ1 and OsSIZ2 based on amino acid sequence homology to AtSIZ1 and their phylogenetic relationship. The function in the vegetative growth and reproductive development in rice was investigated using OsSIZ1 mutants containing a T-DNA insertion. The results showed that the mutant Ossiz1 exhibited the significant changes in several growth and developmental parameters, including primary root length, adventitious root number, plant height, leaf and panicle length, flower formation, and seed-setting rate compared with wild type. Taking together these results indicate that OsSIZ1 plays an important role in regulating growth and development in rice[2].
 +
 
 +
Rice SIZ1, a SUMO E3 ligase, controls spikelet fertility through regulation of anther dehiscence.Genetic results revealed the co-segregation of single T-DNA insertional recessive mutation with the observed phenotypes in siz1. In addition to showing reduced plant height, tiller number and seed set percentage, both the siz1 mutant and SIZ1-RNAi transgenic plants showed obvious defects in anther dehiscence, but not pollen viability. The anther indehiscence in siz1 was probably a result of defects in endothecium development before anthesis. Interestingly, rice orthologs of AtIRX and ZmMADS2, which are essential for endothecium development during anther dehiscence, were significantly down-regulated in siz1. Compared with the wild-type, the sumoylation profile of high-molecular-weight proteins in mature spikelets was reduced significantly in siz1 and the SIZ1-RNAi line with notably reduced SIZ1 expression. The nuclear localization signal located in the SIZ1 C-terminus was sufficient for its nuclear targeting in bombarded onion epidermis.The results suggest the functional role of SIZ1, a SUMO E3 ligase, in regulating rice anther dehiscence[3].
 +
 
 +
Heterologous expression of OsSIZ1, a rice SUMO E3 ligase, enhances broad abiotic stress tolerance in transgenic creeping bentgrass[4].
  
 
===Expression===
 
===Expression===

Revision as of 12:03, 24 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Sumoylation is a post-translational regulatory process in diverse cellular processes in eukaryotes, involving conjugation/deconjugation of small ubiquitin-like modifier (SUMO) proteins to other proteins thus modifying their function. The PIAS [protein inhibitor of activated signal transducers and activators of transcription (STAT)] and SAP (scaffold attachment factor A/B/acinus/PIAS)/MIZ (SIZ) proteins exhibit SUMO E3-ligase activity that facilitates the conjugation of SUMO proteins to target substrates. Here, we report the isolation and molecular characterization of Oryza sativa SIZ1 (OsSIZ1) and SIZ2 (OsSIZ2), rice homologs of Arabidopsis SIZ1. The rice SIZ proteins are localized to the nucleus and showed sumoylation activities in a tobacco system. Our analysis showed increased amounts of SUMO conjugates associated with environmental stresses such as high and low temperature, NaCl and abscisic acid (ABA) in rice plants. The expression of OsSIZ1 and OsSIZ2 in siz1-2 Arabidopsis plants partially complemented the morphological mutant phenotype and enhanced levels of SUMO conjugates under heat shock conditions. In addition, ABA-hypersensitivity of siz1-2 seed germination was partially suppressed by OsSIZ1 and OsSIZ2. The results suggest that rice SIZ1 and SIZ2 are able to functionally complement Arabidopsis SIZ1 in the SUMO conjugation pathway. Their effects on the Arabidopsis mutant suggest a function for these genes related to stress responses and stress adaptation[1].

OsSIZ1 Regulates the Vegetative Growth and Reproductive Development in Rice.Two homologous genes from rice (Oryza sativa) were isolated and designated as OsSIZ1 and OsSIZ2 based on amino acid sequence homology to AtSIZ1 and their phylogenetic relationship. The function in the vegetative growth and reproductive development in rice was investigated using OsSIZ1 mutants containing a T-DNA insertion. The results showed that the mutant Ossiz1 exhibited the significant changes in several growth and developmental parameters, including primary root length, adventitious root number, plant height, leaf and panicle length, flower formation, and seed-setting rate compared with wild type. Taking together these results indicate that OsSIZ1 plays an important role in regulating growth and development in rice[2].

Rice SIZ1, a SUMO E3 ligase, controls spikelet fertility through regulation of anther dehiscence.Genetic results revealed the co-segregation of single T-DNA insertional recessive mutation with the observed phenotypes in siz1. In addition to showing reduced plant height, tiller number and seed set percentage, both the siz1 mutant and SIZ1-RNAi transgenic plants showed obvious defects in anther dehiscence, but not pollen viability. The anther indehiscence in siz1 was probably a result of defects in endothecium development before anthesis. Interestingly, rice orthologs of AtIRX and ZmMADS2, which are essential for endothecium development during anther dehiscence, were significantly down-regulated in siz1. Compared with the wild-type, the sumoylation profile of high-molecular-weight proteins in mature spikelets was reduced significantly in siz1 and the SIZ1-RNAi line with notably reduced SIZ1 expression. The nuclear localization signal located in the SIZ1 C-terminus was sufficient for its nuclear targeting in bombarded onion epidermis.The results suggest the functional role of SIZ1, a SUMO E3 ligase, in regulating rice anther dehiscence[3].

Heterologous expression of OsSIZ1, a rice SUMO E3 ligase, enhances broad abiotic stress tolerance in transgenic creeping bentgrass[4].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0125000

Description

DNA-binding SAP domain containing protein

Version

NM_001061052.1 GI:115461834 GeneID:4337672

Length

11525 bp

Definition

Oryza sativa Japonica Group Os05g0125000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:1404985..1416509

Sequence Coding Region

1405234..1405260,1405979..1406059,1406301..1406343,1406547..1406625,1406734..1406893
,1407008..1407135,1407577..1407645,1408239..1408326,1408959..1409034
,1409210..1409283,1411078..1411185,1412226..1412387,1412622..1412726
,1412890..1412970,1413046..1414246,1415097..1415242

Expression

GEO Profiles:Os05g0125000

Genome Context

<gbrowseImage1> name=NC_008398:1404985..1416509 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:1404985..1416509 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggacctggtttccagctgcaaggataaactggcatactttagaataaaggaactcaaagatatattaaatcagctcggcttaccaaagcaaggaaagaagcaggatcttattgatagggtgttggcactcttaacagatgagcaaggtcaaaggcatcatggatggggaaggaaaaattctctcaccaaggaggcagtggcaaaaattgttgatgatacatacaggaaaatgcaaatccaatgtgctcctgatctagccaccaggagccacagcggatcagatttcagtttcaggcctatagaggaagcctatgactctttccagccagaggccaaagttcgctgcatttgcagtagcacaatggttaatgacagcatgatccagtgtgaagatcagcgatgccaagtgtggcaacatttgaattgtgtactcattccagataagcctggggagagcgctgaagttccacccgttttctactgtgaattatgccgactgagtcgggcagacccattttgggtcactgctggaaatccattactcccagtgaaattcgtgtcatctggtgttacaaatgatggaacaagtgtacctcaaagtgtggagaaaagcttccagctttctcgatcagatagagaaactgtccagagacaagaatatgacctccaggtttggtgcatgcttttgaatgacaaagttcagttcaggatgcagtggccccaatatgcagaattgcatgttaatggtatttctgtacgagtagtgactagacctggttctcaattactagggataaatggacgggatgatggtccactgataaccacatgcagtagagagggaattaataaaatttgcttatcaagggtcgatgctcggacattttgctttggtgttcgaattgctaaacggaggactgttgctcaggttttgaacttagttccaaaggaagctgaaggagagtcttttgagcatgctcttgctcgtgttcggcgctgtctcggaggtggagacactgcagagaatgctgatagtgacagtgatttggaagtggttgcggagtctgttacagtcaaccttcgttgccctaatagtggatccagaatgaggattgctgggagattcaagccttgcattcacatgggttgttttgatcttgaaactttcgtggaattgaatcaacggtcccgcaagtggcaatgtccaatatgtttaaagaattactctcttgagagcttgatgattgatccttacttcaataggattacttctctgttgcgcaattgcaatgaggatgtcaatgaggttgatgttaagcctgacggatcttggcgtgtgaagggtgatgctgcaagtagagaattatctcagtggcatatgcctgatggtaccctttgtaatcctaaggaagatgtcaaacctgccatgcaaaatggaaatgaacaaatgatggaaggtacttctgatggacagaaatctttgaaaattggaataaagagaaatccaaatggaatctgggaagttagtagcaaagcagatgacaagaagccttctgtggttggaaatcgcatgcaaaacaatagtgggttccgagctctaaacaacattatgcatatgagcaatagcccaactagtagttatagagacggggaagacccaagtgtgaaccaagagagcaataggcatgttgacttatcattgaacaatggtaataatgagtttgacagtttctctctcaattttggccaagcatgcaatacagatgatagaccacagcaacaacataatgccacagacgtcattgttcttagtgattctgatgaagagaatgatgctatggtttgtccaccagctgtctatgacaatactaccactgcaaatggtagtggttttcctttcaccactaatggtattggatatactgaaaggtaccaggaagatgccggcgttggtacaagtggccttggtttattgagtaacaatgttgatgattttgagatgaataactggcaaatgcattcttcttatcaacaacctgaacaaggcttccagttttttgggaatgatactgatgtccataatacttttgttggttcacacaattcctttggcttagcaccaaatgactattctcttgattgtaatgttggcgtagaggaggcttcggtaactcctgctctttcagtctgccggaatagtaatgaaatgcatggaagtttggttgataacccactggctttggttggcgatgatccatccttgcaaatttttcttccaagtcaaccttcctctgttcctcttcaggaagaacttagcgagcgtgctaatgcaccaaatggggttcagtctgatgattggatatcccttacactcgcagcgggtggaggtggtaacgaagagcctgcacctgctgatgtcaattcacagccacaaattccatcaacagagacagggatcgaaccattgaccgatgctgcttctgcatttctgagcacaaacattgaaagacgtagcggagctgatttaaatccaagaaggatagaaaatatattttctcatcctcgccagcctcggtctgttaggcctcgactctgtttatcaatagatactgattctgagtag</cdnaseq>

Protein Sequence

<aaseq>MADLVSSCKDKLAYFRIKELKDILNQLGLPKQGKKQDLIDRVLA LLTDEQGQRHHGWGRKNSLTKEAVAKIVDDTYRKMQIQCAPDLATRSHSGSDFSFRPI EEAYDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPV FYCELCRLSRADPFWVTAGNPLLPVKFVSSGVTNDGTSVPQSVEKSFQLSRSDRETVQ RQEYDLQVWCMLLNDKVQFRMQWPQYAELHVNGISVRVVTRPGSQLLGINGRDDGPLI TTCSREGINKICLSRVDARTFCFGVRIAKRRTVAQVLNLVPKEAEGESFEHALARVRR CLGGGDTAENADSDSDLEVVAESVTVNLRCPNSGSRMRIAGRFKPCIHMGCFDLETFV ELNQRSRKWQCPICLKNYSLESLMIDPYFNRITSLLRNCNEDVNEVDVKPDGSWRVKG DAASRELSQWHMPDGTLCNPKEDVKPAMQNGNEQMMEGTSDGQKSLKIGIKRNPNGIW EVSSKADDKKPSVVGNRMQNNSGFRALNNIMHMSNSPTSSYRDGEDPSVNQESNRHVD LSLNNGNNEFDSFSLNFGQACNTDDRPQQQHNATDVIVLSDSDEENDAMVCPPAVYDN TTTANGSGFPFTTNGIGYTERYQEDAGVGTSGLGLLSNNVDDFEMNNWQMHSSYQQPE QGFQFFGNDTDVHNTFVGSHNSFGLAPNDYSLDCNVGVEEASVTPALSVCRNSNEMHG SLVDNPLALVGDDPSLQIFLPSQPSSVPLQEELSERANAPNGVQSDDWISLTLAAGGG GNEEPAPADVNSQPQIPSTETGIEPLTDAASAFLSTNIERRSGADLNPRRIENIFSHP RQPRSVRPRLCLSIDTDSE</aaseq>

Gene Sequence

<dnaseqindica>250..276#995..1075#1317..1359#1563..1641#1750..1909#2024..2151#2593..2661#3255..3342#3975..4050#4226..4299#6094..6201#7242..7403#7638..7742#7906..7986#8062..9262#10113..10258#aaaccacaacgaactaccccctcctcgtcgagccgacgcgagagaggaaagtgggttgcggcttgctgcgcgtgtggagtcgccattccccaattcgctgcgccgcccgccggatctcgtcttgccccctgcggcggcggtttgggcccccccttccgatcggtttcccccccgcacatggtcgtggcggcggcggaggtggtggtggtgcgggagtagggaggcgggcgaaccgaggcggcggcgccgatggcggacctggtttccagctgcaaggtagactcgcgttcccccgcccgccggtaaattcgaccccgatctccgccgattccgcggcgtaattcggcgccggggggggggaggggattcgttgcgtcgcgcgcgtctgttttggggcggggaaggttgcggcgtgcctggccccgcccttgctcgccgtgtttgcctgtagatgatgagatgattagttagttttgtcgatagttttagttttttttttccagtggttgctgtggagtttattagtgcctagctctctggcgtttagggttgcggattaatcggtgatttcagtatagcacctggcgaggggcttcactgggcagttcaattgcttaggctggcgctttcgcttgttggcaaatcccccacatttgcttgatccgtagtttgtcccatgctgtatggttttgtatcatacgggaagcatccagatgtttcatgtcatactaatcactaaataagttgctcagaaaattgctaattttcactttcttcagtttggtagtttgggtccttgtgttccatgacagttaatttagcatggttagttgcgtcatgcttaattccaggcaagagtatctctgctttgatttggaattgatcccagtatttagtccatggatcaaacgccagttgtaccttatgtatgtgtcatgccaaatgaattgctttggtaactttagcattgacccctttgcctttttcattgcaggataaactggcatactttagaataaaggaactcaaagatatattaaatcagctcggcttaccaaagcaaggaaagaagcaggtcagcaaattttgttcctgttaatcttttttacatcaccatctatcagacggcagtttcaactaaatgagaatatgagatgtaagcttttgaggtgaaccggtagtatagactctcataatacagcattggtgggatctttggtggtaatggtggtctgatatgaagagctcatttcaatgagctatttcttagctcgttgtcttttgttttctgatatacttctcttatattctcacaggatcttattgatagggtgttggcactcttaacagatgagcaaggtatgcatttgtctgttgtttctgcttccctggtctatgttagtaccttacatatcaagtcatgtactgacatgctaaaatttgcactgtttcattccctgtatttgtttcagtggtgtctaatccatcagcatgaacggatgatgccttttctattttctagtcttaaaaacctaaatttgtgtgttcttttcttgttgcaggtcaaaggcatcatggatggggaaggaaaaattctctcaccaaggaggcagtggcaaaaattgttgatgatacatacaggttaaatttcattgtttcataaaattgaccatgtggcataatagtgtggatatttgagatgaaatcagtggtgcttctcttttgagatctttatgccttcattagcaggaaaatgcaaatccaatgtgctcctgatctagccaccaggagccacagcggatcagatttcagtttcaggcctatagaggaagcctatgactctttccagccagaggccaaagttcgctgcatttgcagtagcacaatggttaatgacagcatgatccaggtattataacattttttatttcttacattcctttctttttgaaagatcgttacggcatgtgccatccctctttttattattattatttaaatcatgtatcatgtctttctgcagtgtgaagatcagcgatgccaagtgtggcaacatttgaattgtgtactcattccagataagcctggggagagcgctgaagttccacccgttttctactgtgaattatgccgactgagtcgggcagacccgtatgtctttctactatttgatttttctttgggtggggttaagcaggtaaatctgtggtggaaaccactgcattttttaaagaaaaatcaaaacaaaaacatatttagggaaggtgatagtacatgctcttgtaattccatgtgcaaacttgattttgcttgtgagatatgaaaatggaaaacagtgaacgaaaagacaaacatcaagaattcaagatgtgtggcttttaccttgttgtttctcaatttcatatctcattaatgaaattagttttgatcttctgatttcacacagtttaataatgtatcacctcctctgtgcatgagattacttggggattttttgaaacttgtacaaaatggtttccagtttatcaccatatattctacaaaatgggattaagttttgatttgctgcagctacatgctttgaatttgcagattttgggtcactgctggaaatccattactcccagtgaaattcgtgtcatctggtgttacaaatgatgggtgggtataaatggattcttcttactggcaacattttaactgataataatccgtggctgactatttatttattattgatgctcttctttctctatttcgtctttgcaaaaatggcagtttttccaacacctttatttacattcactggtagctcgctaggctctccctttcagtcactccttcaaatagaaaaacagttcatgacacttttttcatcatgcctcttaaatttttttcattgttgcacaatcatagaatgtttacagttacactacggctcataattacatacgtaggtaaaatccattgttgatacttgatagtcatgagtttactttgtcacatgcctctccatatattgtacaaggctcttcttagtagttacttgtcacattataataatccttgtaacatatggtaaattctccagttaacgttatctgtgactatacaacattttgtctagcacatttatggacaacagtatgcttagaaggttcaattgctattctatttactctaaattgtctcgtttaatgatcatgtgttacttgtgatgtatgacatccttattaatcctctcatatctttagaacaagtgtacctcaaagtgtggagaaaagcttccagctttctcgatcagatagagaaactgtccagagacaagaatatgacctccaggtttgttctattctacaaagctaagttaaatatgcttgagttttggagtcctcagttcaacttaatattgcgtcaatattgtaatatcataatgctcttgagtaccaagtaagaaaccatatgggtttatgccactcagttgtttaggacgttcataagtttttttgttgattttaggcttatatgaatagctcttatcaatggtgaaggcaaacctttgaccaattcattttccttttgtaacatggaattcacacaatatgagtaatgcgtctattgtgcaattgttttcattggttgtattgtgaagacaaagcactgtggataagttatgttctctatgtaacatgaaatattcttaatttgttctgttacaagccaactgtatttactttgtgttgttgcaaattttcatctgtaccatgtggatgctacttgctagcattgtacaaagaaattttctttgtgcaaaagtttgaatttatgtggaccaggctgatttcgaattcattttgtccaatgatgaaacatggtttaattcatttcgtattgtttttttccttgcataaatctaagatatgcatgcatatattgtttgtttatactatctgaagcagtgaatgtgttgacaggtttggtgcatgcttttgaatgacaaagttcagttcaggatgcagtggccccaatatgcagaattgcatgttaatggtattgttgatgattttgtagcacaatttgattcactttcatatttgaattgcatcccagcttaaatattgtcttatatgttgtgcagttatgctgttgttggttaatacttcacgttggtctttctttaaaataagttactatctgtgtaacattagtttcattttatgttcaggtatttctgtacgagtagtgactagacctggttctcaattactagggataaatggacgggatgatggtccactggtaagttcaatttccttctgtcacattggtaagatctagatactaattggcagagatttggctatcctatttgatattcctgtatgttattctattttaagttgtgccatttttgttgttctccggttgacagaacctaacgttattgagtggagttacaaccttaaaatggaaccatgttatgttacaaaacctttgggcttgttttcattgatctgtagttaaaatttgctttatcttctagtggcggcctgtaaaaatttgcttctgtatttttaatgctcctatgaaatctcctaaaatcatattcgcagtaactcttaggtggaaagtctcattgagaatcttagctggatgtgtttagtatgagaaaaatttactgcccagtttgaaacagattattgactagattattgtcatggattatttacatgatcatagatatagattaaatatttgataaataaacttaacgaatacagcatagaacaagggatctaaataatgcagtagaagaaaggttttttttttttttgagaaaaacgtagttttagaggcatggagcaaataatctgtgacagtaatccagttaagtagctgaaaagaacagggcctggttgaagatccagttaagcttgcagagtcttgcagctaggggtgatacagttgaaaaccagcattaaggtttggaagaatagtgcattctcttagtttaggaagtactgtgagaacaaccatcggttgacagtagttgttgtcttatctagtcactaggaatcatggccatgagtctgaatcatcagtcgccacaacagtatcacctatcttacccagtgggcaccagccaccatgtgaatcttgcatatggagagctggagacttggcttattgcttattctggtttctaatgattgtaaggctttctattcttattacgcatatcctgtctacgaaaaaggacaatatgccactccattcgttgggtttagacgaaatgccacccactagaatgcaaaggataaaatgccactcaataggttaccttcaggatattttgccactttggggggattttaagaccaaaatacccttggctgtggagagagagaggaagaaagggaaatggctctgctcgccggtggcagcggtgagcgtgcgggggtgagctgcgatgggggaggacagcggcgacgatggggggaggaggacggcagcgctgacgggacggcctcacgcgctcgcagcttgccacctccggcgcctcccccccccctccccccccccccccccccgcgcgtttgccactcaccgctcgctgctcacggcaccgccgtcctcctcccccatcgtcgtccgcccctgcacactcaccaccccccgtcggcaagcacggacactgcccagcttgaccttctccggcgctcccctttcccctctttcttcctctctccacagccaagggtatattggtcttaaaatccctcaaagtggcaaaatatcctgaaggtaacctattgagtggcattttatcctttgcattctagtgggtggcattttgtctgaacccaacgaatggagtggcatattgtcctccttctcctacttggcgttatgcttccattttaaatattcccaggcatagggcattatttttacatgaagcaagctttcacatgcattctttatatagtaacgcttgttgccacattgctttacttttaattatatttccaaagttttggttctgcatagcttgtactatcattctcatggttgttttccctttatttgcagataaccacatgcagtagagagggaattaataaaatttgcttatcaagggtcgatgctcggacattttgctttggtgttcgaattgctaaacggaggactgttgctcaggtatttccatttgaccttttgatttatgaaatgataattttcagattcacttctcccagatgtgtttgttgatttgattgaaatataatctccttttgaaatgtgtacaagcaaaactgaggtttctacatgagtttattgtattcttgaaccatattcctctgtatacatcattgcacttttaattatttcacaagaacgacatttatgagccacaagatcaaattaggaatttatactgtcgagatctttccaaacggttctcaaatttcactcttctctaagggtgctgtcaacactcatctgaccaggaaagaaatccagttagccgcttggtccatcaaccttcattgacattatggtcaagctctgagtactgatagggaaaactgcaaattacaccacaaaaaaaatcatatagtttgcaaagattaacattagctttatctgttggttggtggcaatgactaatagggatatttttgcaagttatgacttcaatgatctgagcattatacgcgtgtttctttttgaactgttgtttcttgtacaccaaactgcttttagtttagaactgttgaatggctttccagttcaatccattttgatggtgatgttcttaatagaaattcgttccacaaattcgctattgaagcatataaatacatatcttgcctaattgttgctgtgaagtgcttactcctctgttttcaaaagaaacaattttgctctacttttaagcagtatgtacattatggtcgtattatgttacatgttcctattgaagtagtcatgcatggtttagtttaacattttctgatgaattacaaaatttaataaagttattacctggaaatgtctgaaattttattaccctcctctttgcttaaaggaagaaacgtatattttaagcataataatgaaagggggaatgctaagcgctgtctttatttccttgagatgtttcattcctctagaaaggccaacaactctcttagctaacaccttttctgattctaattgagctattgtttaaccaggttttgaacttagttccaaaggaagctgaaggagagtcttttgagcatgctcttgctcgtgttcggcgctgtctcggaggtggagacactgcagagaatgctgatagtgacagtgatttggaagtggttgcggagtctgttacagtcaaccttcgttgccctgtgagtttttgttacgtataactgtttagttagcttaacatatgtttgttaagtgtacactacagtatgcagatatagtcattctatcaggttattgatgtccattgttcattgatctggagtagttttagcacatataggttctaatgtcatgtcaagatgtgtgtaaggctaagcctttcttgtgatgcaaaattggagactaatctaatttgttttctaacatgtcttcagaatagtggatccagaatgaggattgctgggagattcaagccttgcattcacatgggttgttttgatcttgaaactttcgtggaattgaatcaacggtcccgcaaggttagatcttgtgttccctgatgctcatccttcagatacatgtgtgttcatccaggaaagagttacttttttctggagctcacaacccaccttttgacatgttgatgctttcatattttccttttatatcctctgattgctcttttctcttgtttctatacagtggcaatgtccaatatgtttaaagaattactctcttgagagcttgatgattgatccttacttcaataggattacttctctggtaagttttcattgtacctctaaatctttttgtcagatccacagcattttgtgattatttttcttttggatgcagttgcgcaattgcaatgaggatgtcaatgaggttgatgttaagcctgacggatcttggcgtgtgaagggtgatgctgcaagtagagaattatctcagtggcatatgcctgatggtaccctttgtaatcctaaggaagatgtcaaacctgccatgcaaaatggaaatgaacaaatgatggaaggtacttctgatggacagaaatctttgaaaattggaataaagagaaatccaaatggaatctgggaagttagtagcaaagcagatgacaagaagccttctgtggttggaaatcgcatgcaaaacaatagtgggttccgagctctaaacaacattatgcatatgagcaatagcccaactagtagttatagagacggggaagacccaagtgtgaaccaagagagcaataggcatgttgacttatcattgaacaatggtaataatgagtttgacagtttctctctcaattttggccaagcatgcaatacagatgatagaccacagcaacaacataatgccacagacgtcattgttcttagtgattctgatgaagagaatgatgctatggtttgtccaccagctgtctatgacaatactaccactgcaaatggtagtggttttcctttcaccactaatggtattggatatactgaaaggtaccaggaagatgccggcgttggtacaagtggccttggtttattgagtaacaatgttgatgattttgagatgaataactggcaaatgcattcttcttatcaacaacctgaacaaggcttccagttttttgggaatgatactgatgtccataatacttttgttggttcacacaattcctttggcttagcaccaaatgactattctcttgattgtaatgttggcgtagaggaggcttcggtaactcctgctctttcagtctgccggaatagtaatgaaatgcatggaagtttggttgataacccactggctttggttggcgatgatccatccttgcaaatttttcttccaagtcaaccttcctctgttcctcttcaggaagaacttagcgagcgtgctaatgcaccaaatggggttcagtctgatgattggatatcccttacactcgcagcgggtggaggtggtaacgaagagcctgcacctgctgatgtcaattcacagccacaaattccatcaacagagacagggatcgaaccattgaccgatgctggtttgtctcccttttccgagtttagttctttattcatgtgacagttatattctaaggcaatggtttactcttgaaatatttttaccaacaacttaaaatttctatccatttgcttagtcatattttttttcagttgaattatttccttgtatgatattatatccgtgcgtgatactttgcttttccatgttttcataactagttaaattggctaacaattatcttaacataattttgttgtgaactgattactgactggaaagaaaacagtgatgaattagcacaatgtggataagactactggaaacatagttgctgctaacctttggtgatccttgagtatctcttcaactaagttaccaagcatgattattccacctttttgtttcatgagtaaagagttcattagtttttgctcttaatgcattttttaggggctgcagagacccacatcaccaattgtattgctaagcttatacttgtagcaaatgtcgattcacaccgggcctgctttctcttttctttagtaacactaccaattttgaaggaatttgcgtagtatcaagatatttattataccaaatgcttctaagcctgtcttctattatcagcccatctctagggtggtttggtagttacaatttctatggattttgctgtctgttatggtcgcctgtataacaggggttatgcttggttggaacatatgcaggaacatccaggtcttttgtctgctagtggttattgttgggtgttcccaccactatcatcatgtattatcagcaattattgttgtgattgctcagttggtccaaaatattggcataattcctttactcgttttttgcagcttctgcatttctgagcacaaacattgaaagacgtagcggagctgatttaaatccaagaaggatagaaaatatattttctcatcctcgccagcctcggtctgttaggcctcgactctgtttatcaatagatactgattctgagtagtttggacatcataacggggtaactgagtttgcattagtttggcaaagctgccatccagaaatcatgatttatactgaggtggggttatcggtcgtctggttgatgtaaagaaaaacaccagcattgatgctttgttgcctcaatggtttacaagctttcaagtgttctatttgatccaggagggatctgcatagaggacatctgatggtgagcataactgattagtccttttcccctgtgttactgttccagtttccttgtagtttgttgtttgcatgtgattaaagttgttaatttgcaagtgggcatgtcttttaccaaatgaaaagggaaagaatgacatagaagatcccttcccattcattaatgacaccatctggagttcgatcacaataggataaaaatgttgcagattataacaggataaataagagcaaattaatatgctgttagtttctaagcacatcatgaagttgaatattcattcttataaagcttgtttgtgcttcgattggctttagagcttacacatcatgttaggttctcttatttgcatttcccaaaatttagttgttgtctgacatatattcatatgtaacacaaaacatctacagtagtcgagattttcagataagatgggagtcgcagtgagtaagcatagctgtgtaggcttcttgttagaagcttgtctaaagtagttctttgccagcagtcaatgaataaaatttgcaatatatatgtctgcttctctgggtagtagaattattcgctgaagtagtccaaataagaagtaaaagatttgaacctcgtataacaagaatgttcccagtttcttgtgcagttgttaacagatgatgctataaggtttttactttaatatcacagaaattgttgaggcttgtcaacaaaaaaaggcatgatactgtagttacattccttctcattggaggtcgctaatgttttttttttttttctgttaggttggtatagaaaattttctaactgggtatcgaggcttaatgtggcgactggagcagtttgtacattttttttgttttgacttttactggatataaggaatagaggtggggtcatccctggaccctggatgcaagacaaatacatgtgaatgttttgggtgtaccatcattgtatttagggtttgggggtactaatttagttgtttattaacctggtatttgatggagaataaattattcctggaagtggcggccaataaacagagtcgttggggttttacttgggt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0125000, RefSeq:Os05g0125000