Difference between revisions of "Os12g0281300"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
  
The rice blast resistance gene, Pi-ta, originally introgressed into japonica from indica rice is important in breeding for rice blast resistance worldwide. In the southern USA, the rice cultivar Katy contains Pi-ta and is resistant to the predominant blast M. grisea races IB-49 and IC-17 and has been used as the blast resistant breeding parent. Three pairs of DNA primers specific to the dominant indica Pi-ta gene were designed to amplify the Pi-ta DNA fragments by polymerase chain reaction (PCR). Rice expressing the Pi-ta gene is resistant to strains of the rice blast fungus, Magnaporthe grisea, expressing AVR-Pita in a gene-for-gene relationship. Pi-ta encodes a putative cytoplasmic receptor with a centrally localized nucleotide-binding site and leucine-rich domain (LRD) at the C-terminus. AVR-Pita is predicted to encode a metalloprotease with an N-terminal secretory signal and pro-protein sequences. AVR-Pita176 lacks the secretory and pro-protein sequences.
+
The rice blast resistance gene, Pi-ta, originally introgressed into japonica from indica rice is important in breeding for rice blast resistance worldwide. In the southern USA, the rice cultivar Katy contains Pi-ta and is resistant to the predominant blast M. grisea races IB-49 and IC-17 and has been used as the blast resistant breeding parent. Three pairs of DNA primers specific to the dominant indica Pi-ta gene were designed to amplify the Pi-ta DNA fragments by polymerase chain reaction (PCR).  
 +
 
 +
[[File:Figure 4. Blast symptoms of rice.png]]
 +
 
 +
Rice expressing the Pi-ta gene is resistant to strains of the rice blast fungus, Magnaporthe grisea, expressing AVR-Pita in a gene-for-gene relationship. Pi-ta encodes a putative cytoplasmic receptor with a centrally localized nucleotide-binding site and leucine-rich domain (LRD) at the C-terminus. AVR-Pita is predicted to encode a metalloprotease with an N-terminal secretory signal and pro-protein sequences. AVR-Pita176 lacks the secretory and pro-protein sequences.
  
 
[[File:Figure 3. Structure diagram of rice accessions carrying Pi-ta.png]]
 
[[File:Figure 3. Structure diagram of rice accessions carrying Pi-ta.png]]

Revision as of 12:58, 24 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The rice blast resistance gene, Pi-ta, originally introgressed into japonica from indica rice is important in breeding for rice blast resistance worldwide. In the southern USA, the rice cultivar Katy contains Pi-ta and is resistant to the predominant blast M. grisea races IB-49 and IC-17 and has been used as the blast resistant breeding parent. Three pairs of DNA primers specific to the dominant indica Pi-ta gene were designed to amplify the Pi-ta DNA fragments by polymerase chain reaction (PCR).

Figure 4. Blast symptoms of rice.png

Rice expressing the Pi-ta gene is resistant to strains of the rice blast fungus, Magnaporthe grisea, expressing AVR-Pita in a gene-for-gene relationship. Pi-ta encodes a putative cytoplasmic receptor with a centrally localized nucleotide-binding site and leucine-rich domain (LRD) at the C-terminus. AVR-Pita is predicted to encode a metalloprotease with an N-terminal secretory signal and pro-protein sequences. AVR-Pita176 lacks the secretory and pro-protein sequences.

Figure 3. Structure diagram of rice accessions carrying Pi-ta.png

Expression

AVR-Pita176 protein is shown to bind specifically to the LRD of the Pi-ta protein, both in the yeast two-hybrid system and in an in vitro binding assay. Single amino acid substitutions in the Pi-ta LRD or in the AVR-Pita176 protease motif that result in loss of resistance in the plant also disrupt the physical interaction, both in yeast and in vitro.


Figure 2. Phylogenetic tree showing groups of US weedy rice among rice.png

The Pi-ta containing rice lines, as determined by PCR analysis, were resistant to both IB-49 and IC-17 in standard pathogenicity assays.

Evolution

You can also add sub-section(s) at will. Rice expressing the Pi-ta gene is resistant to strains of the rice blast fungus, Magnaporthe grisea, expressing AVR-Pita in a gene-for-gene relationship. Pi-ta encodes a putative cytoplasmic receptor with a centrally localized nucleotide-binding site and leucine-rich domain (LRD) at the C-terminus. AVR-Pita is predicted to encode a metalloprotease with an N-terminal secretory signal and pro-protein sequences. AVR-Pita176 lacks the secretory and pro-protein sequences.

Figure 5. Extended haplotype homozygosity (EHH) at and around Pi-ta.png

Labs working on this gene

1.Dale Bumpers National Rice Research Center, Agricultural Research Service, United States Department of Agriculture, Stuttgart, Arkansas, United States of America 2.Institute of Plant Biology, National Taiwan University, Taipei 106, Taiwan 3.Department of Botany, National Museum of Natural Science, Taichung 404, Taiwan, 4.Department of Life Science, National Taiwan Normal University, Taipei 116, Taiwan 5.Department of Life Science, Pingtung University of Science and Technology, Pingtung 912, Taiwan 6.Faculty of Agriculture, Hokkaido University, 060, Sapporo, Japan

References

1. Seonghee Lee;Yulin Jia;Melissa Jia;David R. Gealy;Kenneth M. Olsen;Ana L. Caicedo

 Molecular Evolution of the Rice Blast Resistance Gene Pi-ta in Invasive Weedy Rice in the USA
 PLoS ONE, 2011, 6(10): e26260

2. X. Wang;R. Fjellstrom;Y. Jia;W. G. Yan;M. H. Jia;B. E. Scheffler;D. Wu;Q. Shu;A. McClung

 Characterization of Pi-ta blast resistance gene in an international rice core collection
 Plant Breeding, 2010, 129(5): 491-501

3. Yulin Jia;Rodger Martin

 Identification of a New Locus, Ptr(t), Required for Rice Blast Resistance Gene Pi-ta–Mediated Resistance
 Molecular Plant-Microbe Interactions, 2008, 21(4): 396-403

4. Chun-Lin Huang;Shih-Ying Hwang;Yu-Chung Chiang;Tsan-Piao Lin

 Molecular Evolution of the Pi-ta Gene Resistant to Rice Blast in Wild Rice (Oryza rufipogon)
 Genetics, 2008, 179(3): 1527-1538

5. 王忠华;贾育林;吴殿星;夏英武

 水稻抗稻瘟病基因Pi-ta的分子标记辅助选择
 作物学报, 2004, 30(12): 1259-1265

Structured Information

Gene Name

Os12g0281300

Description

Similar to Pi-ta protein

Version

NM_001073106.1 GI:115488173 GeneID:4351983

Length

5556 bp

Definition

Oryza sativa Japonica Group Os12g0281300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

{{{Chromosome}}}

Location

Chromosome 12:10605422..10610977

Sequence Coding Region

10605623..10606017,10606490..10606533,10606706..10608424,10609890..10610833

Expression

GEO Profiles:Os12g0281300

Genome Context

<gbrowseImage1> name=NC_008405:10605422..10610977 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:10605422..10610977 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgccggcggtcagtgcatcgcagggtgtcatcatgcggtccctgacgagcaagctcgactcgctgctgctgcagccgccggagccgccgccgcctgcgcaaccgtcgtcgctgcggaagggggagaggaagaagatcctcctcctcagaggcgatctccgacacctgctagatgactactacctcctcgtggagccgccgtcagacaccgcgccaccgccagactcgacggcggcgtgctgggctaaggaggttcgcgagctctcctacgacgtcgacgacttcctcgacgagctaacgacccagctcctccaccaccgcggcggcggcgatggcagtagcactgctggtgccaagaagatgatcagcagcatgatcgcccggcttcgaggggagcttaaccggcggcggtggatcgccgacgaggtcaccctgttcagcgcccgcgtgaaggaggccattcgccgccaggagagctaccatcttggcaggcgcacctcgagctcgaggccgagagaagaagtcgacgacgacgatcgcgaggactccgccggcaacgaacgccgccggtttctgtcgctgacgttcgggatggacgacgctgctgtgcacggccagctcgttggtagggatatttcgatgcaaaagctcgtccggtggctggccgacggcgagccgaagctcaaggtggcttccattgttggatccggaggtgttggcaagacgacgctggccacagaattctatcgtctgcatggccggcggttggatgcgccgttcgactgccgggctttcgtgcggacgccccggaagcctgacatgacgaagatcctcaccgacatgctgtcacagctgcggccacaacatcagcatcagtcttcggatgtttgggaggttgatcgactccttgaaactatccggacgcatttgcaagataaaaggtacttcatcataattgaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtggatataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagataacaggtaatatcacagttaaacttccagagaagatccaaggactacaacacttgcagacactggaagcagatgcaagagcaactgctgtcctattggatattgttcatacacagtgtttgttgcaccttcgtcttgtactacttgatctgctccctcactgtcacaggtacatcttcaccagcatccccaaatggactggaaagctcaacaatctccgcattttaaacattgcagtcatgcaaatttcccaggatgaccttgacactctcaaaggactgggatctctcactgctctttcgctgcttgttcgaacagcgcctgcgcaaagaatcgtcgctgcgaatgaggggttcgggtctctcaagtacttcatgtttgtctgtacagcaccatgcatgacttttgtggaaggagcaatgccgagtgtgcaaagattaaatctaaggttcaatgccaacgagttcaagcagtatgactctaaggagacagggttggaacacttggtcgcccttgcagagatctctgcaagaattgggggcactgatgatgatgaatcaaacaaaactgaagtggagtctgccttgaggactgcaattcgcaagcatccgacgccgagcactcttatggttgatatacaatgggtggattggatctttggtgctgaagggagagacttggatgaagatttggcacaacaagatgatcacgggttttgtatgctaccggaatcctcttcacgtcttcagagtagagagataagtatcgaagaagacatgcccaccggtgcggaagggacggtgattgtgccccacacaatggagcagttcgccctccacatgagccaagccaagcaatcccacaagctcgtagtcatccagttcactacttcccggtgccctgcttcacgctacatcgcgccagctttcaccgagtatgcgaaggagttcgctggtgcggttttcattaaggtcaatgtcgacagcgatgagctggagagtgttacggactggtatgacatcgaagggatagtgccaacatttttcttcgtcaaggatggggagaagattgacaagattcctggtgctaacaaggagttgctccgagccaaaattcgaaggcacacagcttctccttacttcctccgttga</cdnaseq>

Protein Sequence

<aaseq>MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGER KKILLLRGDLRHLLDDYYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTT QLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQES YHLGRRTSSSRPREEVDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKL VRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMT KILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSR GLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEF PGHLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTL QGMRQVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINSIENKVME EVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQT TVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLIL CFWADQEKTSYDLTSISELLQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVL LDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKLNNLRILNIAVMQISQDDLDT LKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCTAPCMTFVEGAMPSVQRLN LRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKTEVESALRTAIRKHPTP STLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGFCMLPESSSRLQSREISIEEDMPTGA EGTVIVPHTMEQFALHMSQAKQSHKLVVIQFTTSRCPASRYIAPAFTEYAKEFAGAVF IKVNVDSDELESVTDWYDIEGIVPTFFFVKDGEKIDKIPGANKELLRAKIRRHTASPY FLR</aaseq>

Gene Sequence

<dnaseqindica>4961..5355#4445..4488#2554..4272#145..1088#agataggattaagtttcaagagttaatttcttgtactcttgggcgatccatgctgtcaaatcagcaactaacgaggcataatctcgatcactagctctgatctgatcttcagctagcgccggcgagctgcagaggtctccatccatggcgccggcggtcagtgcatcgcagggtgtcatcatgcggtccctgacgagcaagctcgactcgctgctgctgcagccgccggagccgccgccgcctgcgcaaccgtcgtcgctgcggaagggggagaggaagaagatcctcctcctcagaggcgatctccgacacctgctagatgactactacctcctcgtggagccgccgtcagacaccgcgccaccgccagactcgacggcggcgtgctgggctaaggaggttcgcgagctctcctacgacgtcgacgacttcctcgacgagctaacgacccagctcctccaccaccgcggcggcggcgatggcagtagcactgctggtgccaagaagatgatcagcagcatgatcgcccggcttcgaggggagcttaaccggcggcggtggatcgccgacgaggtcaccctgttcagcgcccgcgtgaaggaggccattcgccgccaggagagctaccatcttggcaggcgcacctcgagctcgaggccgagagaagaagtcgacgacgacgatcgcgaggactccgccggcaacgaacgccgccggtttctgtcgctgacgttcgggatggacgacgctgctgtgcacggccagctcgttggtagggatatttcgatgcaaaagctcgtccggtggctggccgacggcgagccgaagctcaaggtggcttccattgttggatccggaggtgttggcaagacgacgctggccacagaattctatcgtctgcatggccggcggttggatgcgccgttcgactgccgggctttcgtgcggacgccccggaagcctgacatgacgaagatcctcaccgacatgctgtcacagctgcggccacaacatcagcatcagtcttcggatgtttgggaggttgatcgactccttgaaactatccggacgcatttgcaagataaaaggtaattcatgtctacatctatctctagtatttttttcatgaatttacaaactattttctcaaatttccccttttttatccttcatatagtaattaagttagtaactatacatatgaatttaatttactcgacaatgccaataatattttaaattacttttatagtgccctctattagtagatacgattcgatcgagccatgaattatactggtaatctaaacaattattatacccacctcattctactaacagcaattgagttgttaatataaatagatatggtctattgcatgaaaaaataaaggtaaagtgtttacattatttctactactagtagaagaactacaaagttgtttgtatttttaattattaaatgtaaatgaaagtatatgtttcatacccttgttattttttttaggcgactaaactactagtacattatttctactactagtagaacaactacaaagttgtttgtatttttaattactaaatgtaaatgaaagtacatgcttcatacccttgttataattttttagactaaactaccacaatggcatgttaacttatagcagtaagttgtaatttattttcttttcattttctcagttgttacaagaacttttttttacttaataaaaaatagtcgtaagggcctcccttgttcggtcaaaaaagaattagactaaactcaatcgtatttgtacataaacaaaatttaaaatataactaaaacgaaacagtgataaaaatggtgcaatttaactgctgcctcttgttttaatgtctgacaatgttgattttgtatatatgtttggccatttattttattcaaattttttacaaatatgaaaaatataatatatgcttaaattacttttaatgataaaataaatttaaaaaaatgataattatatttttaataagatggatgatctaacatatatatgtccaaaagtttgacatcaaacattaaaaacaagagagagtatttgcttaggagtacgtgtctttttccatgtctaagaacaggtacaatagcaggttataagctagctataaacatattttaaagagatataggaagagagagaagagcagcagcctacagatctgtagccagctgcagcacggactctaagacgtaatgtgtgtatgacaggtaggaccaagtattaatagtatagtaagcaactattgtatgaattggctatttggctctagatgatttggagctagtagtcggctatactattaaacttgctcttagatatgtggttaaatttaatttctgaaatttacaagatatagaacatgtcttcaccatgtttgcaaagttgataaaatgaaattgcactcaactttttaaattcagcatgctatcccacgtatagctttttaaatatgatttattttttcgtacattagaagtttaatgtttacgaagtactaaatgttctgcaggtacttcatcataattgaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtggatataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagataacaggtaatatcacagttaaacttccagagaagatccaaggactacaacacttgcagacactggaagcagatgcaagagcaactgctgtcctattggatattgttcatacacagtgtttgttgcaccttcgtcttgtactacttgatctgctccctcactgtcacaggtacatcttcaccagcatccccaaatggactggaaagctcaacaatctccgcattttaaacattgcagtcatgcaaatttcccaggatgaccttgacactctcaaaggactgggatctctcactgctctttcgctgcttgttcgaacagcgcctgcgcaaagaatcgtcgctgcgaatgaggggttcgggtctctcaagtacttcatgtttgtctgtacagcaccatgcatgacttttgtggaaggagcaatgccgagtgtgcaaagattaaatctaaggttcaatgccaacgagttcaagcagtatgactctaaggagacagggttggaacacttggtcgcccttgcagagatctctgcaagaattgggggcactgatgatgatgaatcaaacaaaactgaagtggagtctgccttgaggactgcaattcgcaagcatccgacgccgagcactcttatggttgatatacaatgggtggattggatctttggtgctgaagggagagacttggatgaagatttggcacaacaagatgatcacgggtatggatttttcattctattcccaggttacaacttacaaggattattgagcttctttctttctctgccgtggcttctatctttaccttctatgcatcttcaacctgacttgatgattgtttgaaaccaattttaatggaagttaaatgttattgttgtgaccctgaatcaggttttgtatgctaccggaatcctcttcacgtcttcagagtagaggtaattttgtttcttgtcattttacagttacagttcatctacttaaggaattaatgggaggtcctatattttctcgggtacctagaaggtgtggttcctagtcttacctccttaagaaccgtagaatgttggccctaacacttggatcaaagaacgaaaggtgtatgcactatagtatcctttatatattgcacaagtcaagacatttgttaaaacacacccagtgctagtaatttgtttactgagatatgaattatcgccaaatacccatactgagcctattagtaaaatatttacgaggtgtttgaggacagcataactttcagtaaagaatttactacgtgaggtgtgtgttttaggtattgcgcatcttgggtgcattttagcgcaaacgtgtataatatatatcccatggtactaactcatgtcttaaccataattgcacaccaacacaaaacatacactactacagagataagtatcgaagaagacatgcccaccggtgcggaagggacggtgattgtgccccacacaatggagcagttcgccctccacatgagccaagccaagcaatcccacaagctcgtagtcatccagttcactacttcccggtgccctgcttcacgctacatcgcgccagctttcaccgagtatgcgaaggagttcgctggtgcggttttcattaaggtcaatgtcgacagcgatgagctggagagtgttacggactggtatgacatcgaagggatagtgccaacatttttcttcgtcaaggatggggagaagattgacaagattcctggtgctaacaaggagttgctccgagccaaaattcgaaggcacacagcttctccttacttcctccgttgataatgacttcttttatcgtctttgtctagtatatatatggcacttatatagttaactaggaagggcaccttgtttaatgtagctttcatttttattatgaatgttaaggatgatattatattgttgaagtatttttttactccttgtaaacatgtattggttaataacgaagtagtttggacattagttatgattttcttc</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0281300, RefSeq:Os12g0281300