Difference between revisions of "Os10g0528300"
(→Evolution) |
(→Evolution) |
||
| Line 11: | Line 11: | ||
===Evolution=== | ===Evolution=== | ||
Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and | Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and | ||
| − | evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.[[File:Phylogenetic tree.png|200px|thumb| | + | evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.[[File:Phylogenetic tree.png|200px|thumb|right|Phylogenetic relationship among rice and Arabidopsis GST proteins and their classification.|Phylogenetic relationship among rice and Arabidopsis GST proteins and their classification. |
The unrooted tree was constructed based on multiple sequence alignment of full-length protein sequences using ClustalX program by neighbor-joining method with 1000 bootstrap replicates. The numbers at the nodes represent bootstrap values (≥ 500) from 1000 replicates. All the rice and Arabidopsis GST proteins grouped into seven classes. The bar indicates 0.1 substitutions per site. The cluster of Tau class GST genes present only in rice is indicated in box.]] | The unrooted tree was constructed based on multiple sequence alignment of full-length protein sequences using ClustalX program by neighbor-joining method with 1000 bootstrap replicates. The numbers at the nodes represent bootstrap values (≥ 500) from 1000 replicates. All the rice and Arabidopsis GST proteins grouped into seven classes. The bar indicates 0.1 substitutions per site. The cluster of Tau class GST genes present only in rice is indicated in box.]] | ||
Revision as of 15:11, 24 May 2014
Os10g0528300 is Oryza sativa Indica Group mRNA for glutathione S-transferase (gstu4 gene).
Contents
Annotated Information
Function
Three glutathione S-transferases (GSTs: OsGSTU3, OsGSTU4 and OsGSTU12) that belong to the plant-specific tau class were markedly overexpressed in roots following Cd(Cadmium) exposure.GSTs have been reported to be involved in the direct quenching of Cd ions, forming GSH–Cd complexes (Adamis et al., 2004).The RT-PCR product levels of the osgstu3 and osgstu4 genes in rice roots increase in response to salicylic acid,jasmonic acid and the auxina-naphthalene acetic acid, as well as
heavy metals.
Expression
Please input expression information here.
Evolution
Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and
evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os10g0528300 |
|---|---|
| Description |
Tau class GST protein 4 |
| Version |
NM_001071658.1 GI:115483059 GeneID:4349189 |
| Length |
1397 bp |
| Definition |
Oryza sativa Japonica Group Os10g0528300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:21011686..21013082 |
| Sequence Coding Region |
21011756..21012088,21012317..21012703 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:21011686..21013082 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:21011686..21013082 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccggatcaggagacgagctgatgctgctcggcaaatggccaagcccattcgtcaccagggttgagctcgcgctcggcctcaagggcctcagctacgagtacgtcaagcaggacctcgtcaacaagagcgagctcctcctcgcctccaacccggtgcacaagaagatccccgtgctcatccacaacggcaagccggtctgcgagtcgtcaatcatcgtgcagtacatcgacgaggccttccccgacgccggcgccggcgccgccctgctccccgccgacccctacgagcgcgccgtcgctcgcttctgggtcgcctacgtcgacgacaagttcgttccggcatgggtggcgacgttcagaggcaagacggaggaggagaaggcggaggggatgaagcaactgctcgcggcggtggagacgctggagggagccctgaaggattgctccaaggggaagcccttcttcggcggcgacacagtcgggatcgtggacgtcgcgcttggtggcctcatctcgtgggtgaaagcgaccgaggtgctcgctggctccaagatcttcgacgaggagaaggcccctcttttggccgcgtgggcgcagcgcttcggcgagctcgacgtcgccgagaaggtgttgccggatgtcgacggggtggtcgagttcgctaagatgaggctggcagaggcagctgcggctgccgcggcggcttcaaaaaactaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAGSGDELMLLGKWPSPFVTRVELALGLKGLSYEYVKQDLVNKS ELLLASNPVHKKIPVLIHNGKPVCESSIIVQYIDEAFPDAGAGAALLPADPYERAVAR FWVAYVDDKFVPAWVATFRGKTEEEKAEGMKQLLAAVETLEGALKDCSKGKPFFGGDT VGIVDVALGGLISWVKATEVLAGSKIFDEEKAPLLAAWAQRFGELDVAEKVLPDVDGV VEFAKMRLAEAAAAAAAASKN</aaseq> |
| Gene Sequence |
<dnaseqindica>71..403#632..1018#tacgcagcaaaacacaatccaaagcgtgttcatccaatcattctctgttccgctctctcaccccagcgagatggccggatcaggagacgagctgatgctgctcggcaaatggccaagcccattcgtcaccagggttgagctcgcgctcggcctcaagggcctcagctacgagtacgtcaagcaggacctcgtcaacaagagcgagctcctcctcgcctccaacccggtgcacaagaagatccccgtgctcatccacaacggcaagccggtctgcgagtcgtcaatcatcgtgcagtacatcgacgaggccttccccgacgccggcgccggcgccgccctgctccccgccgacccctacgagcgcgccgtcgctcgcttctgggtcgcctacgtcgacgacaaggtaggatagctaagctacctttccttcatttgtgtcacagttcgagctgttatctcaaaacacaaatattagggaatgatctaatatcaaataattcgaaggatgatgctctaaacccaaatcggctagcccactaccttgtgaaactagccagaaaactcccgggcatttctctcgaggtttttatctcactgatgcgatgatgtgttgggtggcgcgtgcgtgcagttcgttccggcatgggtggcgacgttcagaggcaagacggaggaggagaaggcggaggggatgaagcaactgctcgcggcggtggagacgctggagggagccctgaaggattgctccaaggggaagcccttcttcggcggcgacacagtcgggatcgtggacgtcgcgcttggtggcctcatctcgtgggtgaaagcgaccgaggtgctcgctggctccaagatcttcgacgaggagaaggcccctcttttggccgcgtgggcgcagcgcttcggcgagctcgacgtcgccgagaaggtgttgccggatgtcgacggggtggtcgagttcgctaagatgaggctggcagaggcagctgcggctgccgcggcggcttcaaaaaactaagatggatatgtttggttatgtcgtggtaactcccattgtttgggagaaaataatgtgcttgttggaaaaattatttgggagaaactaatgtgcttgttggaaaagaatagatttagttgatttagtgttttttctgtatcagtatcttgatttatgtctgaataatgcaaggaatattcaatgaagtcatgaagatgcttgtcctctgtttattcagtagttaggggatctttttcttctgttggtgtctattagtttgtgtttgcttagctttgtttatactatcgtgaactttctatataagtttttttctgtgtgagttctaaaataattgactataactctttaagtaaaggccggaatgttttattctattatt</dnaseqindica> |
| External Link(s) |