Difference between revisions of "Os05g0429900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 14: Line 14:
  
 
[[File:zxq1.png|200px|thumb|left|Fig. 1. RNA blot analysis.]]
 
[[File:zxq1.png|200px|thumb|left|Fig. 1. RNA blot analysis.]]
 +
 +
 +
Fig:Transcripts of OsSSI2, two OsSSI2 homologs,
 +
WRKY45, and PR1b were analyzed in wild-type (WT) and OsSSI2 mutant
 +
plants. OsSSI2 transcripts were not detected in homozygous Osssi2-Tos17
 +
(NF7039) and OsSSI2-knockdown (kd) plants, whereas the expression of
 +
the two closest homologs of OsSSI2 (i.e., Os04g0379900 and
 +
Os01g0880800) was unaffected in these plants. The arrow indicates a band
 +
of fusion transcripts encoding OsSSI2 with the Tos17 insertion. The salicylic
 +
acid/benzothiadiazole-induced gene WRKY45 and the pathogenesis-related
 +
gene OsPR1b were constitutively expressed in the NF7039 and OsSSI2-kd
 +
plants. Leaf blades from the fourth leaves of seedlings were used.
  
 
===Evolution===
 
===Evolution===

Revision as of 02:13, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Prediction of subcellular targeting by using the TargetP and WoLF PSORT prediction programs suggested that Os01g0919900, Os01g0880800, and Os08g0199400 are localized in the chloplast or mitochondrion, whereas the others are present in chloroplasts.

Fig. 1. RNA blot analysis.


Fig:Transcripts of OsSSI2, two OsSSI2 homologs, WRKY45, and PR1b were analyzed in wild-type (WT) and OsSSI2 mutant plants. OsSSI2 transcripts were not detected in homozygous Osssi2-Tos17 (NF7039) and OsSSI2-knockdown (kd) plants, whereas the expression of the two closest homologs of OsSSI2 (i.e., Os04g0379900 and Os01g0880800) was unaffected in these plants. The arrow indicates a band of fusion transcripts encoding OsSSI2 with the Tos17 insertion. The salicylic acid/benzothiadiazole-induced gene WRKY45 and the pathogenesis-related gene OsPR1b were constitutively expressed in the NF7039 and OsSSI2-kd plants. Leaf blades from the fourth leaves of seedlings were used.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0429900

Description

Similar to MybHv5 (Fragment)

Version

NM_001187510.1 GI:297724150 GeneID:9266213

Length

1279 bp

Definition

Oryza sativa Japonica Group Os05g0429900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:21106104..21107382

Sequence Coding Region

21106375..21106894,21106995..21107257

Expression

GEO Profiles:Os05g0429900

Genome Context

<gbrowseImage1> name=NC_008398:21106104..21107382 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:21106104..21107382 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatga</cdnaseq>

Protein Sequence

<aaseq>MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAA GLLRCGKSCRLRWMNYLRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDN EIKNYWNTHIKRKLLARGIDPQTHRPLLSGGDGIAASNKAAPPPPHPISVPAKAAAAA IFAVAKPPPPPRPVDSSDDGCRSSSGTTSTGEPRCPDLNLELSVGPTPSSPPAETPTS ARPVCLCYHLGFRGGEACSCQADSKGPHEFRYFRPLEQGQYI</aaseq>

Gene Sequence

<dnaseqindica>489..1008#126..388#ccgccgcggctcacctggaaactgggcagattggacaatcgctcgagcgagctagcgagagagagcgcgagagagcgaggcggcgcgcgcggtggttgcggatttgtagcttagagcgcggggccatggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtcagtctccctccccccgtctccggcgccgccgccaccgatcgatggagcattcatcaattccttgtgattctcaattcggtttcgcttcttctttcaggtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatgagatatgaccatgagatgtgagatggcttaattagcttcaattcccaacatgtgtaacacagggagtttttctagtggacgacaatactgtttaatttcagaaaaaaaaagggaaagaaaaaggttctaatctgttcatatttcttactattatccaatcttcatgatctcaatctctctctctctttattatttttctttgtagtaattaacttcatgttggttcctctaaaaaagattggtcgatgttattcagtgataaatattcctag</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0429900, RefSeq:Os05g0429900