Difference between revisions of "Os01g0822900"
(→Function) |
(→Expression) |
||
| Line 19: | Line 19: | ||
'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals. (Fig.3) | '''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals. (Fig.3) | ||
| − | [[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg| | + | [[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg|left|thumb|500px|'''Figure 2.''' |
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]'']] | ''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]'']] | ||
Revision as of 06:26, 25 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
- A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.[1]
- Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf(D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive,[2] though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.
Expression
- It is expressed in elongating stem, vegetative sheath and young inflorescence.
(1)Expression analysis of flowering-related genes, Hd3a, RFT1, Ehd1, Ghd7and DTH8 in the Psd1 mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so Psd1 mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)
(2)Psd1-related genetic network is regulated by day-length dependent signals. (Fig.3)
Figure 3.(from reference [1]).
Wide Type VS Mutant
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os01g0822900 |
|---|---|
| Description |
Similar to Lipid transfer protein |
| Version |
NM_001051189.1 GI:115440748 GeneID:4327617 |
| Length |
901 bp |
| Definition |
Oryza sativa Japonica Group Os01g0822900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:36885860..36886760 |
| Sequence Coding Region |
36886214..36886223,36886310..36886662 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:36885860..36886760 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:36885860..36886760 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq> |
| Protein Sequence |
<aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq> |
| Gene Sequence |
<dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica> |
| External Link(s) |
