Difference between revisions of "Os09g0401100"

From RiceWiki
Jump to: navigation, search
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
The half-size ABC transporters STR1 and STR2 are indis- pensable for mycorrhizal arbuscule formation in rice
 +
The central structureof thesymbiotic association betweenplants and arbuscularmycorrhizal (AM) fungi is the fungal arbuscule that delivers minerals to the plant. Our earlier transcriptome analyses identified two half-size ABCG transporters that displayed enhanced mRNA levels in mycorrhizal roots. We now show specific transcript accumulation in arbusculated cells of both genes during symbiosis. Presently, arbuscule-relevant factors from monocotyledons have not been reported. Mutation of either of the Oryza sativa (rice) ABCG transporters blocked arbuscule growth of different AM fungi at a small and stunted stage, recapitulating the phenotype of Medicago truncatula stunted arbuscule 1 and 2 (str1 and str2) mutants that are deficient in homologous ABCG genes. This phenotypic resemblance and phylogenetic analysis suggest functional conservation of STR1 and STR2 across the angiosperms. Malnutrition of the fungus underlying limited arbuscular growth was excluded by the absence of complementation of the str1 phenotype by wild-type nurse plants. Furthermore, plant AM signaling was found to be intact, as arbuscule-induced marker transcript accumulation was not affected in str1 mutants. Strigolactones have previously been hypothesized to operate as intracellular hyphal branching signals and possible substrates of STR1 and STR2. However, full arbuscule development in the strigolactone biosynthesis mutants d10 and d17 suggested strigolactones to be unlikely substrates of STR1/STR2. Interestingly, rice STR1 is associated with a cis-natural antisense transcript (antiSTR1). Analogous to STR1 and STR2, at the root cortex level, the antiSTR1 transcript is specifically detected in arbusculated cells, suggesting unexpected modes of STR1 regulation in rice.
  
 
===Expression===
 
===Expression===

Revision as of 07:57, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. The half-size ABC transporters STR1 and STR2 are indis- pensable for mycorrhizal arbuscule formation in rice The central structureof thesymbiotic association betweenplants and arbuscularmycorrhizal (AM) fungi is the fungal arbuscule that delivers minerals to the plant. Our earlier transcriptome analyses identified two half-size ABCG transporters that displayed enhanced mRNA levels in mycorrhizal roots. We now show specific transcript accumulation in arbusculated cells of both genes during symbiosis. Presently, arbuscule-relevant factors from monocotyledons have not been reported. Mutation of either of the Oryza sativa (rice) ABCG transporters blocked arbuscule growth of different AM fungi at a small and stunted stage, recapitulating the phenotype of Medicago truncatula stunted arbuscule 1 and 2 (str1 and str2) mutants that are deficient in homologous ABCG genes. This phenotypic resemblance and phylogenetic analysis suggest functional conservation of STR1 and STR2 across the angiosperms. Malnutrition of the fungus underlying limited arbuscular growth was excluded by the absence of complementation of the str1 phenotype by wild-type nurse plants. Furthermore, plant AM signaling was found to be intact, as arbuscule-induced marker transcript accumulation was not affected in str1 mutants. Strigolactones have previously been hypothesized to operate as intracellular hyphal branching signals and possible substrates of STR1 and STR2. However, full arbuscule development in the strigolactone biosynthesis mutants d10 and d17 suggested strigolactones to be unlikely substrates of STR1/STR2. Interestingly, rice STR1 is associated with a cis-natural antisense transcript (antiSTR1). Analogous to STR1 and STR2, at the root cortex level, the antiSTR1 transcript is specifically detected in arbusculated cells, suggesting unexpected modes of STR1 regulation in rice.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0401100

Description

ABC transporter related domain containing protein

Version

NM_001069654.2 GI:297609427 GeneID:4346998

Length

3671 bp

Definition

Oryza sativa Japonica Group Os09g0401100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:14700465..14704135

Sequence Coding Region

14700465..14700986,14701363..14701542,14701785..14702039,14702597..14704135

Expression

GEO Profiles:Os09g0401100

Genome Context

<gbrowseImage1> name=NC_008402:14700465..14704135 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:14700465..14704135 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcagcagcagcagcgcagccgtgagatggccagggccggcgagccagccgccgcccaccgccaccgcgccgagagggccgccgccggcgagccggccacccgaactcaccggacagagagagccggcgagcctgccgcggccaccaccaccaccaccacccgccggccgccgccgacgacgacggagaggaaggagagcctggagagcctcctggacgcgacggacgccgcccgtggcggccgtcgcggcggcggcggcgtgaaggcggcggtggccagcaggcaagggctggagttcaagaacctgtcgtacagcgtggtgaagaagcagaagaaggagggggtgaaggtgaagaaggaggtgtacctgctcaacgacatctccggcgaggccccccgcgggcaggtgacggcgatcctcggccccagcggcgccggcaagtccaccttcctcgacgccctcgccggccggatcgccaagggcagcctcgagggctccgtccgcatcgacggccgagctgtcacgacgagctacatgaagcagatttcatcctacgtgatgcaagatgatcagttgttcccgatgctgacggtgctggagacgctcactttcgcagctgaagtgaggctgcccccatcactctccagagctgagaagctcaagcgagtctgggagctcatcgatcagcttggtttgcagacaacggctcacacgtacattggggatgaagggacccgaggagtctccggtggggaacgccggagggtgtcgatcggcatagacatcatccacaaaccttccctcctcttcctcgacgagccgacctccggtctcgactccaccagcgcgcacagcgtggtggagaaggtgaaggacatcgccagaggagggagcattgtgctcatgacgattcaccagccatctttcaggatccagatgcttcttgacaggcttgagtacgatgaatcaacatcggggcttgagcctctggttgcctaccagagggacggcacgaaacccgacggcgccgcgaaaactccggtgccaagaacaccgagaacgccgcaccagaagtcggtgcagttcaggcagatccaactcaagagcaaccagttctccctcaacagcggcgccgccaatggcaacaccttctccaacttcgagtcgtcgtacaatgtcgatggcggcggcgatgacgacgatgaggattttgataattcgctcgagaggaagttgcagacgccgatgcacgccggcggtccagcttcggggtaccagccgaggctggcgtcacagttctacaaggatttctcggtctgggtctaccatggcgtcaccgggagcacgccgcaccggcggccgacatggacaccggcgagaacgccggtgtcgagcttccagcgtggccgcgccgtgacaatgacgccaacgccgcagaacaacccgcagcggcggcctcctccgcctccgtctccacatgtgccggtgttcaagccggaggagccgacgtaccacgagtacgagcttgacctggagccgccgctggacgcgccggaagaggactacaacggcggccatcgtcccaagttcgccaacccgtggccgcgggaggtggcggtgctgtcgtggcgcacggtgctcaacgtggtgcgcacgccggagctgttcctctctagggaggtggtgctcgcggcgatggcggtcatcctctccaccatgttccgccgcctcggcgccggcgacgtcccgacggtgaaccggctgctcaacttctacatcttcgccgtctgcctcgtcttcttctcctccaacgacgccgtgccaaccttcatccaggagcggttcatcttcatccgggagcggtcgcacaacgcctacagggcgtcgtcctacgtcgtcgcctccctcgtcgtctacctccccttcttcgccgtgcaagggctcaccttcgccgtgatcaccaagctgatgctccggatggagagcagcctgctccacttctgggtcatcctcttcgcctccctcatcaccaccaacgcctacgtcatgctcgtctcggcgctcgtccccagctacatcaccggctacgccgtcgtcatcgcgacgacggcgctcttcttcctcacctgcggcttcttcctcaagcggacgctcatcccggtggggtggaggtggctgcactacgcctccgcgatcaagtacccgttcgaggcgctgctggtgagcgagttcaaggggggccggtgctacgccggcgaccgcgccgacctctcgccggggccgctcggggggttcaagcccagcagcctccggcgggagctcaacgccagcgacgcggcgtgcccgttgatggggcaggacgtgctctccacactggacatcaccattgacagcatctgggttgatgttgccatcctgcttgcatggggtgtcctctatcgcctcctcttctatgttgtcttgaggttctactccaagaatgagaggaagtga</cdnaseq>

Protein Sequence

<aaseq>MQQQQRSREMARAGEPAAAHRHRAERAAAGEPATRTHRTERAGE PAAATTTTTTRRPPPTTTERKESLESLLDATDAARGGRRGGGGVKAAVASRQGLEFKN LSYSVVKKQKKEGVKVKKEVYLLNDISGEAPRGQVTAILGPSGAGKSTFLDALAGRIA KGSLEGSVRIDGRAVTTSYMKQISSYVMQDDQLFPMLTVLETLTFAAEVRLPPSLSRA EKLKRVWELIDQLGLQTTAHTYIGDEGTRGVSGGERRRVSIGIDIIHKPSLLFLDEPT SGLDSTSAHSVVEKVKDIARGGSIVLMTIHQPSFRIQMLLDRLEYDESTSGLEPLVAY QRDGTKPDGAAKTPVPRTPRTPHQKSVQFRQIQLKSNQFSLNSGAANGNTFSNFESSY NVDGGGDDDDEDFDNSLERKLQTPMHAGGPASGYQPRLASQFYKDFSVWVYHGVTGST PHRRPTWTPARTPVSSFQRGRAVTMTPTPQNNPQRRPPPPPSPHVPVFKPEEPTYHEY ELDLEPPLDAPEEDYNGGHRPKFANPWPREVAVLSWRTVLNVVRTPELFLSREVVLAA MAVILSTMFRRLGAGDVPTVNRLLNFYIFAVCLVFFSSNDAVPTFIQERFIFIRERSH NAYRASSYVVASLVVYLPFFAVQGLTFAVITKLMLRMESSLLHFWVILFASLITTNAY VMLVSALVPSYITGYAVVIATTALFFLTCGFFLKRTLIPVGWRWLHYASAIKYPFEAL LVSEFKGGRCYAGDRADLSPGPLGGFKPSSLRRELNASDAACPLMGQDVLSTLDITID SIWVDVAILLAWGVLYRLLFYVVLRFYSKNERK</aaseq>

Gene Sequence

<dnaseqindica>1..522#899..1078#1321..1575#2133..3671#atgcagcagcagcagcgcagccgtgagatggccagggccggcgagccagccgccgcccaccgccaccgcgccgagagggccgccgccggcgagccggccacccgaactcaccggacagagagagccggcgagcctgccgcggccaccaccaccaccaccacccgccggccgccgccgacgacgacggagaggaaggagagcctggagagcctcctggacgcgacggacgccgcccgtggcggccgtcgcggcggcggcggcgtgaaggcggcggtggccagcaggcaagggctggagttcaagaacctgtcgtacagcgtggtgaagaagcagaagaaggagggggtgaaggtgaagaaggaggtgtacctgctcaacgacatctccggcgaggccccccgcgggcaggtgacggcgatcctcggccccagcggcgccggcaagtccaccttcctcgacgccctcgccggccggatcgccaagggcagcctcgagggctccgtccgcatcgacggccgagctgtaagatgaatcgatgatcatcaaacacccataaaattaacctacttcctctgtttccgtttcatgttacaagatgttttaactttggttaaaaccaaactactttaaatttaactaagtttaaagaaaaaataataacattttcaaccttagacaaatttattatgaaaatatatttaattattgatttaatgaaactaattcggtattataaatattactatatttgtttataaacttagttaaaaattagtttaactttgacctaagtcaaatcgtcttgtaacttgaaacgaagagagtatacagttctctcgttcttctgcataatcaagtacacaattaagatgatctcttgttcttgttgttaatttaggtcacgacgagctacatgaagcagatttcatcctacgtgatgcaagatgatcagttgttcccgatgctgacggtgctggagacgctcactttcgcagctgaagtgaggctgcccccatcactctccagagctgagaagctcaagcgagtctgggagctcatcgatcagcttggtttgcaggtaagtcaatcaaattaatccgatagagcagttttccgatacttgagaatgtaccaggtccaatttaataccgagagataccaaattttacattaaaaaaatacggtatccttagaaccgtaaaaatctctctaatctgaccattaaacaaataatatcgacagaattgtagctggttatactctacaagctaggttagcagcttgctcatttttactgacaatctgtgtgccaaattgcagacaacggctcacacgtacattggggatgaagggacccgaggagtctccggtggggaacgccggagggtgtcgatcggcatagacatcatccacaaaccttccctcctcttcctcgacgagccgacctccggtctcgactccaccagcgcgcacagcgtggtggagaaggtgaaggacatcgccagaggagggagcattgtgctcatgacgattcaccagccatctttcaggatccagatgcttcttgacaggcttgtcatcctcgcaaggtgacaaaactatttctccctccgtttcaggttataagatgttttgactttggtcaaagtcaaactgcttcaagtttgattaagtttatagaaaaaatagtaatattttttactcatgataaatttattattaaaatatatttaattattaatttaataaaattattttggtaatataaatattactatattcgtctataaacttggtcaaacttaaaacagtttgactttcaccaaagttaaaaccttatagactgaaacgaaacgagttatagatagtattccaaattgttagtgtctaattttaaaagtttgaccaaatcttgtctgaatgaccggaggaagtatctgcctaggtctagaattgtcttttgcttccaaaattccttttttgttcaatttaaaaatactgtcattgattcatccaggggaaggttgatctacctaggaagcccaagcacactgcaaacacacctggctggatttggcaggccggtgccggatggtgagaacagcattgagtatctcctggatgtcatcaaggagtacgatgaatcaacatcggggcttgagcctctggttgcctaccagagggacggcacgaaacccgacggcgccgcgaaaactccggtgccaagaacaccgagaacgccgcaccagaagtcggtgcagttcaggcagatccaactcaagagcaaccagttctccctcaacagcggcgccgccaatggcaacaccttctccaacttcgagtcgtcgtacaatgtcgatggcggcggcgatgacgacgatgaggattttgataattcgctcgagaggaagttgcagacgccgatgcacgccggcggtccagcttcggggtaccagccgaggctggcgtcacagttctacaaggatttctcggtctgggtctaccatggcgtcaccgggagcacgccgcaccggcggccgacatggacaccggcgagaacgccggtgtcgagcttccagcgtggccgcgccgtgacaatgacgccaacgccgcagaacaacccgcagcggcggcctcctccgcctccgtctccacatgtgccggtgttcaagccggaggagccgacgtaccacgagtacgagcttgacctggagccgccgctggacgcgccggaagaggactacaacggcggccatcgtcccaagttcgccaacccgtggccgcgggaggtggcggtgctgtcgtggcgcacggtgctcaacgtggtgcgcacgccggagctgttcctctctagggaggtggtgctcgcggcgatggcggtcatcctctccaccatgttccgccgcctcggcgccggcgacgtcccgacggtgaaccggctgctcaacttctacatcttcgccgtctgcctcgtcttcttctcctccaacgacgccgtgccaaccttcatccaggagcggttcatcttcatccgggagcggtcgcacaacgcctacagggcgtcgtcctacgtcgtcgcctccctcgtcgtctacctccccttcttcgccgtgcaagggctcaccttcgccgtgatcaccaagctgatgctccggatggagagcagcctgctccacttctgggtcatcctcttcgcctccctcatcaccaccaacgcctacgtcatgctcgtctcggcgctcgtccccagctacatcaccggctacgccgtcgtcatcgcgacgacggcgctcttcttcctcacctgcggcttcttcctcaagcggacgctcatcccggtggggtggaggtggctgcactacgcctccgcgatcaagtacccgttcgaggcgctgctggtgagcgagttcaaggggggccggtgctacgccggcgaccgcgccgacctctcgccggggccgctcggggggttcaagcccagcagcctccggcgggagctcaacgccagcgacgcggcgtgcccgttgatggggcaggacgtgctctccacactggacatcaccattgacagcatctgggttgatgttgccatcctgcttgcatggggtgtcctctatcgcctcctcttctatgttgtcttgaggttctactccaagaatgagaggaagtga</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0401100, RefSeq:Os09g0401100