Difference between revisions of "Os03g0848700"

From RiceWiki
Jump to: navigation, search
Line 2: Line 2:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
[[File:Ra4-20.jpg|right|thumb|200px|'''Figure 1.'''Planthopper-resistance test of theBph14-transgenic and wild-type rice at the mature stage. Magnified views show the locations of BPH feeding.(from reference <ref name="ref1" />).]]
+
[[File:Ra4-20.jpg|right|thumb|200px|'''Figure 1. '''Planthopper-resistance test of theBph14-transgenic and wild-type rice at the mature stage. Magnified views show the locations of BPH feeding.(from reference <ref name="ref1" />).]]
  
 
''Bph14'' was first mapped from the introgression line B5, derived from ''O. officinalis'', with ''Qbp1'' (renamed as ''Bph14'') on chromosome 3 explaining 26.4% of the phenotypic variance of BPH resistance in this population<ref name="ref2" />. ''Bph14'' encodes a coiled-coil, nucleotide-binding, and leucine-rich repeat (CC-NB-LRR) protein. Sequence comparison indicates that ''Bph14'' carries a unique LRR domain that might function in recognition of the BPH insect invasion and activating the defense response. ''Bph14'' is predominantly expressed in vascular bundles, the site of BPH feeding<ref name="ref1" />. Expression of ''Bph14'' activates the salicylic acid signalling pathway and induces callose deposition in phloem cells and trypsin inhibitor production after planthopper infestation, thus shows antibiosis and antixenosis effects on BPH, like delaying the development of males and decreasing the female ratio and copulation rate, as well as the antixenosis action against BPH nymphs, female adults and ovipositon, and what's more, some P450 members of the CYP4 and CYP6 family in BPH are inducible by host allelochemicals, like CYP6AX1, CYP6AY1, CYP4C61, CYP4C62, CYP6CS1, CYP6CW1 and CYP303A1<ref name="ref3" />. ''Bph14'' showed a stable resistance in different genetic backgrounds and thus is valuable in development of resistant rice varieties<ref name="ref1" />.
 
''Bph14'' was first mapped from the introgression line B5, derived from ''O. officinalis'', with ''Qbp1'' (renamed as ''Bph14'') on chromosome 3 explaining 26.4% of the phenotypic variance of BPH resistance in this population<ref name="ref2" />. ''Bph14'' encodes a coiled-coil, nucleotide-binding, and leucine-rich repeat (CC-NB-LRR) protein. Sequence comparison indicates that ''Bph14'' carries a unique LRR domain that might function in recognition of the BPH insect invasion and activating the defense response. ''Bph14'' is predominantly expressed in vascular bundles, the site of BPH feeding<ref name="ref1" />. Expression of ''Bph14'' activates the salicylic acid signalling pathway and induces callose deposition in phloem cells and trypsin inhibitor production after planthopper infestation, thus shows antibiosis and antixenosis effects on BPH, like delaying the development of males and decreasing the female ratio and copulation rate, as well as the antixenosis action against BPH nymphs, female adults and ovipositon, and what's more, some P450 members of the CYP4 and CYP6 family in BPH are inducible by host allelochemicals, like CYP6AX1, CYP6AY1, CYP4C61, CYP4C62, CYP6CS1, CYP6CW1 and CYP303A1<ref name="ref3" />. ''Bph14'' showed a stable resistance in different genetic backgrounds and thus is valuable in development of resistant rice varieties<ref name="ref1" />.
Line 33: Line 33:
 
===Evolution===
 
===Evolution===
 
Bph14 shares 83% sequence identity with its allele (Os03g0848700) in Nipponbare. Phylogenetic analysis revealed that Bph14 is closely related to other rice homologs and is divergent from the majority of known plant disease resistance proteins in other species. See the picture of phylogenetic analysis on the right hand.
 
Bph14 shares 83% sequence identity with its allele (Os03g0848700) in Nipponbare. Phylogenetic analysis revealed that Bph14 is closely related to other rice homologs and is divergent from the majority of known plant disease resistance proteins in other species. See the picture of phylogenetic analysis on the right hand.
[[File:Phylogenetic Analysis.png|250px|thumb|right|'''Figure 3.'''Phylogenetic relationships of Bph14 homologs in rice (Os), wheat (Ta), cassava (Me), potato (Sb), tomato (Le), maize (Zm), barley (Hv), and Arabidopsis (At). (Scale bar, 0.1 amino acid substitutions per site.)  (from reference <ref name="ref1" />).]]
+
[[File:Phylogenetic Analysis.png|250px|thumb|right|'''Figure 3. '''Phylogenetic relationships of Bph14 homologs in rice (Os), wheat (Ta), cassava (Me), potato (Sb), tomato (Le), maize (Zm), barley (Hv), and Arabidopsis (At). (Scale bar, 0.1 amino acid substitutions per site.)  (from reference <ref name="ref1" />).]]
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 08:22, 25 May 2014

Bph14 is a gene conferring resistance to Brown planthopper (BPH) at seedling and maturity stages of the rice plant.

Annotated Information

Function

Figure 1. Planthopper-resistance test of theBph14-transgenic and wild-type rice at the mature stage. Magnified views show the locations of BPH feeding.(from reference [1]).

Bph14 was first mapped from the introgression line B5, derived from O. officinalis, with Qbp1 (renamed as Bph14) on chromosome 3 explaining 26.4% of the phenotypic variance of BPH resistance in this population[2]. Bph14 encodes a coiled-coil, nucleotide-binding, and leucine-rich repeat (CC-NB-LRR) protein. Sequence comparison indicates that Bph14 carries a unique LRR domain that might function in recognition of the BPH insect invasion and activating the defense response. Bph14 is predominantly expressed in vascular bundles, the site of BPH feeding[1]. Expression of Bph14 activates the salicylic acid signalling pathway and induces callose deposition in phloem cells and trypsin inhibitor production after planthopper infestation, thus shows antibiosis and antixenosis effects on BPH, like delaying the development of males and decreasing the female ratio and copulation rate, as well as the antixenosis action against BPH nymphs, female adults and ovipositon, and what's more, some P450 members of the CYP4 and CYP6 family in BPH are inducible by host allelochemicals, like CYP6AX1, CYP6AY1, CYP4C61, CYP4C62, CYP6CS1, CYP6CW1 and CYP303A1[3]. Bph14 showed a stable resistance in different genetic backgrounds and thus is valuable in development of resistant rice varieties[1].

GO assignment(s): GO:0009625

Expression

Bph14 is expressed constitutively in leaf sheaths, leaf blades, and roots. Bph14 activity was examined using transgenic plants carrying the fusion construct of the Bph14 promoter region and the GUS reporter gene. The expression of GUS in transgenic plants was detected mainly in the vascular tissue of various organs, including leaf sheaths and leaf blades. In cross-sections of these organs, GUS activity was strongly detected in the parenchyma cells bordering xylem vessels and sieve tubes. Such an expression pattern is consistent with the role of Bph14 in recognizing BPH attack in phloem cells.

Bph14 have been identified in B5 and mapped on the long arm of rice chromosome 3【2】(B5 is a rice line derived from the wild rice Oryza officinalis and is highly resistant to the BPH biotypes 1 and 2.).Bph14 is predominantly expressed in vascular bundles,the site of BPH feeding.Bph14 encodes a coiled-coil, nucleotide-binding, and leucine-rich repeat (CC-NB-LRR) protein

Primer Forward primer Reverse primer
Gene amplication 5'-GGCGACTGCGAATGCTAT-3' 5'-GGCAGATCATCACCAACTCC-3' (used to amplify Bph14 [4])
5'-CTACAGGCAGCCAGCAGAT-3' 5'-TCCTGTCAGATTCTTGCACTG-3' (used to amplify LRR domain [4])

Localization

The Bph14-GFP fusion protein is localized in the cytoplasm.

Figure 2. Bph14 subcellular localization. (from reference[1]).

Evolution

Bph14 shares 83% sequence identity with its allele (Os03g0848700) in Nipponbare. Phylogenetic analysis revealed that Bph14 is closely related to other rice homologs and is divergent from the majority of known plant disease resistance proteins in other species. See the picture of phylogenetic analysis on the right hand.

Figure 3. Phylogenetic relationships of Bph14 homologs in rice (Os), wheat (Ta), cassava (Me), potato (Sb), tomato (Le), maize (Zm), barley (Hv), and Arabidopsis (At). (Scale bar, 0.1 amino acid substitutions per site.) (from reference [1]).

Labs working on this gene

  • Key Laboratory of Ministry of Education for Plant Development Biology, College of Life Sciences, Wuhan University, Wuhan 430072, China
  • National Center for Gene Research, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200233, China
  • Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China
  • College of Plant Science and Technology, Huazhong Agricultural University, Wuhan 430070, China

References

  1. 1.0 1.1 1.2 1.3 1.4 Bo Dua, Weilin Zhanga,Bingfang Liua, et al. (2009) Identification and characterization of Bph14, a gene conferring resistance to brown planthopper in rice.Proceedings of the National Academy of Sciences, 106(52): 22163-22168.
  2. Huang Z, He GC, Shu LH, et al. (2001) Identification and mapping of two brown planthopper resistance genes in rice. Theor Appl Genet 102:929–934.
  3. Jie Li, Qiuhong Chen, Liangquan Wang, et al. (2011) Biological effects of rice harbouring Bph14 and Bph15 on brown planthopper, Nilaparvata lugens. Pest Management Science, 67:528–534.
  4. 4.0 4.1 Zhou Lei, Zhijun Chen, Xuyong Lang, et al. (2013) Development and validation of a PCR-based functional marker system for the brown planthopper resistance gene Bph14 in rice. Breeding Science, 63:347–352.

Structured Information

Gene Name

Os03g0848700

Description

Similar to TDRGA-1 (Fragment)

Version

NM_001058430.1 GI:115456588 GeneID:4334783

Length

5725 bp

Definition

Oryza sativa Japonica Group Os03g0848700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:36544018..36549742

Sequence Coding Region

36544479..36544552,36545320..36549226

Expression

GEO Profiles:Os03g0848700

Genome Context

<gbrowseImage1> name=NC_008396:36544018..36549742 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:36544018..36549742 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcagagctgatggccaccatggtggtcgggccactgctgtccatggtgaaggacaaggcctccagctacctcctggagcagtacaaggtcatggagggcatggaggagcagcatgagattctcaaacgcaagctgcccgccatcctcgacgtcatcgccgacgccgaggagcaggcggcaaaacacagggaaggggcgaaagcatggcttgaggagctccggaaggtggcctaccaggccaatgatgtcttcgacgagttcaagtacgaggcactccgccgcaaagccaaggccaaggggcactacaagaagctcggcagcattgttgttataaagctcattcctactcacaaccgtattctgtttcgttataggatgggcaacaagctcaggatgatcctgaatgccattgaagtcctaattgcagagatgaatgcctttaggtttaagttccgaccagagccaccaatgtcctccatcaaatggagaaagacggattctaaaatctccaacctttctatggacattgccaacaagtcaagaaagaaagacaaagaggagattgtcaatcgattgcttgctcaagccagcaatggggatctcactgttattcccattgtaggaatgggggggatgggcaagaccaccttagcgcagctcgtttacaatgaccctgaaattcagaagcattttcagttgctgctctggttgtgtgtctctgacaacttcgatgtggattcgctggcaaaaagaatagttgaagcagctcccaaagaaatgaataagaagaatgataatggaggggccaaaaagttaccacaggatgaacttaaagaagttgtgagtgggcagaggtacctcctcattttggatgatgtctggaaccgtgatgccagtaagtgggaagcactcaagtacaaccttaagcatggtggcagcggtagctcagttttgacaacaactcgtgatcaagcagttgctcaactaatggctccagctcaagaagtttatgatctcaagaacctgaatgaaagcttcattgaggaaattatcaagagaagtgctttcaattcagaacaagaaaggcctcctcctgagctactcgaaatggttggtgatattgccaagaaatgttctggttcccctttagctgcaacagcattgggctctacactgcgtacgaagaccaccaagaaagaatgggacgctatattgagcagaagcacaatttgcgatgaggaaaatggaattttaccaatactcaaactcagttacaattgcttgccatcatatatgcggcaatgtttttccttctgtgctatttttcccaaggatcatgagatcgacgtggaaatgctgatccagttatggatggccaatggttttatcccggagaaacaaggagagtgccctgaaatcattggtaaaagaattttcagtgagttggtgtcaaggtcattttttcaggatgtgaaggggatcccatttgagttccatgatataaagtgctctaagattacttgtaagatccatgaccttatgcatgatgttgcacaatcttccatgggaaaagaatgcgctactatagctacagaacttagtaaaagtgatgattttccttattccgctcgccacttgtttttctcaggtgtcattttcctaaagaaagtatatccaggtatccaaacattgatatgttcctcgcaagaagaattgatacgttcctcgcgagaaatatcaaaatacagttcattgcgagctttaaagatggggggagattcattcctgaaaccaaaatatcttcatcacctgaggtatcttgatttgtcatacagtaaaattgaagcacttcctgaagacataagcatcctatatcatctgcaaacattgaacctttccatttgtgactgtctttgtcaactcccaaacggaatgaagtacatgaccgccctccgtcacttgtacactcacggatgttggaggttaaaaagcatgcctccggacctcggacacctcacttgcctacagacgcttacatgttttgtagccggttcttgctctggctgcagtgatttgggagagctgcggcagttggaccttggtggtcgactagagctaagaaaactggaaaatgtgacaaaagctgatgcaaaagcagcaaatctcggaaagaaggaaaaactgaccgaattgagcttaagatggactggtcagaagtacaaggaggcacagagtaataatcataaagaggtgctggaaggtctcacgcctcacgaggggctcaaggttctgagtatacttcactgtgggagcagtacatgtccaacatggatgaataaactgcgggacatggtgaagcttgtgttagatggttgcaaaaatctcgagaagcttcctccactgtggcagctgccagctctagaagttctttgccttgaaggactggatggtttaaattgcttgttcaactgtgacatatacacctcctttacattttgcagactgaaggagcttaccttggccagtatgagaaattttgagacatggtgggacacaaatgaggtaaaaggagaagagctgatatttcctgaggttgaaaagctgataatcaaaagttgtcctaggctaactgccttaccaaaagcgtcaaatgtgatttcagaattgtctggcggagttagcaccgtgtgtcattctgcatttccagcattgaaggaaatggaattatatggtttggatatctttcagaaatgggaggcagtcgatggaactccaagggaggaggtaacatttcctcagctttacaaattagatattagacggtgcccagagttgactactctacctgaagcaccaaagctgagagacttaaacatatatgaagtcaatcagcaaatatccctacaggcagccagcagatatattacttcattgtccagtctccacctgcatttgtcaactgatgacacagaaacagcaccggtggccaagcaacaagattcgagtgaattggtgattgaggatgagaaatggaatcataaatctcccctggaacttatggacttaactggctgcaaccttttattctcttacccaagtgcgttggctctgtggacatgttttgttcagctcctagatctgaatatttgggaagtcgatgcgcttgtcgactggccagaagaggtgttccagggcttggtttccttgaggaagttacatattcttcaatgcaagaatctgacaggactcacacaagctcgtgggcaatctacactagcaccaagtgaactcctgccacgtttggagtccctgcagatacgccgttgttattcttttgtagaggtccccaacctaccgacgtctctcaagctattacaaattacggactgccatgacctgaggtccatcatattcaatcagcagcaggatacgacgatgttggtgagtgcagaaagcttcgcacagccggacaagtcatcgttaatatcagggtccaccagcgagaccaacgatcgcgtccttccacgcctagaatctctagtaatagagtattgcaatcgtttgaaggttctccatcttcctccgtccatcaagaaattggatattgtacgctgtgaaaaacttcagtcactctcaggaaagctggatgccgttcgagcattaaatatcagctattgcgggagcttgaaatcactggaatcttgcttaggagagctcccgtcgctgcaacacctcagacttgttaattgcccaggcctggtatccttgccgaaggggcctcaagcatactcatctcttacatctcttgaaattcgttattgttctggtataaatttgcttccaccgagcctgcagcaacgtctggatgacatcgagaataaagaactagatgcctgctatgaagaatcagaggcaaaaccagaaccaaagtctcctcatcgtcaatctgcaatcagtaggctgctgtgcttggagtag</cdnaseq>

Protein Sequence

<aaseq>MAELMATMVVGPLLSMVKDKASSYLLEQYKVMEGMEEQHEILKR KLPAILDVIADAEEQAAKHREGAKAWLEELRKVAYQANDVFDEFKYEALRRKAKAKGH YKKLGSIVVIKLIPTHNRILFRYRMGNKLRMILNAIEVLIAEMNAFRFKFRPEPPMSS IKWRKTDSKISNLSMDIANKSRKKDKEEIVNRLLAQASNGDLTVIPIVGMGGMGKTTL AQLVYNDPEIQKHFQLLLWLCVSDNFDVDSLAKRIVEAAPKEMNKKNDNGGAKKLPQD ELKEVVSGQRYLLILDDVWNRDASKWEALKYNLKHGGSGSSVLTTTRDQAVAQLMAPA QEVYDLKNLNESFIEEIIKRSAFNSEQERPPPELLEMVGDIAKKCSGSPLAATALGST LRTKTTKKEWDAILSRSTICDEENGILPILKLSYNCLPSYMRQCFSFCAIFPKDHEID VEMLIQLWMANGFIPEKQGECPEIIGKRIFSELVSRSFFQDVKGIPFEFHDIKCSKIT CKIHDLMHDVAQSSMGKECATIATELSKSDDFPYSARHLFFSGVIFLKKVYPGIQTLI CSSQEELIRSSREISKYSSLRALKMGGDSFLKPKYLHHLRYLDLSYSKIEALPEDISI LYHLQTLNLSICDCLCQLPNGMKYMTALRHLYTHGCWRLKSMPPDLGHLTCLQTLTCF VAGSCSGCSDLGELRQLDLGGRLELRKLENVTKADAKAANLGKKEKLTELSLRWTGQK YKEAQSNNHKEVLEGLTPHEGLKVLSILHCGSSTCPTWMNKLRDMVKLVLDGCKNLEK LPPLWQLPALEVLCLEGLDGLNCLFNCDIYTSFTFCRLKELTLASMRNFETWWDTNEV KGEELIFPEVEKLIIKSCPRLTALPKASNVISELSGGVSTVCHSAFPALKEMELYGLD IFQKWEAVDGTPREEVTFPQLYKLDIRRCPELTTLPEAPKLRDLNIYEVNQQISLQAA SRYITSLSSLHLHLSTDDTETAPVAKQQDSSELVIEDEKWNHKSPLELMDLTGCNLLF SYPSALALWTCFVQLLDLNIWEVDALVDWPEEVFQGLVSLRKLHILQCKNLTGLTQAR GQSTLAPSELLPRLESLQIRRCYSFVEVPNLPTSLKLLQITDCHDLRSIIFNQQQDTT MLVSAESFAQPDKSSLISGSTSETNDRVLPRLESLVIEYCNRLKVLHLPPSIKKLDIV RCEKLQSLSGKLDAVRALNISYCGSLKSLESCLGELPSLQHLRLVNCPGLVSLPKGPQ AYSSLTSLEIRYCSGINLLPPSLQQRLDDIENKELDACYEESEAKPEPKSPHRQSAIS RLLCLE</aaseq>

Gene Sequence

<dnaseqindica>5191..5264#517..4423#acgggctacagcggcgagtgacgcgcttgcggctgcaggctgctgagctcgtccgtcaagcgccgccttaatttgagacgggtccgagcagctccaaccttgctctccacgaaccggccaagcccaattcgccgttgagttccggtcgacggaggaacacaagaacgacagggcaccacaccggtgagcatcccagcttcttctcagctatcgtcagtacttcgtggttgcgcttgcgccgaccgaccggcttctctcccgcgcactccagttttctatctctatcgtcgcccagttctcggaagcttactgcactgtactgtacttgcttacttcttcattccaatcaaacactttcattccaggcagcaactcttaatactagctagttgcattcagttaaacacattccttcagtttccatttcccacaaaaagcagctgctgctcacactccttgcttattgtgcttccctgtgttctgttcgtgtgttcttagctctaggagatccttccgatggcagagctgatggccaccatggtggtcgggccactgctgtccatggtgaaggacaaggcctccagctacctcctggagcagtacaaggtcatggagggcatggaggagcagcatgagattctcaaacgcaagctgcccgccatcctcgacgtcatcgccgacgccgaggagcaggcggcaaaacacagggaaggggcgaaagcatggcttgaggagctccggaaggtggcctaccaggccaatgatgtcttcgacgagttcaagtacgaggcactccgccgcaaagccaaggccaaggggcactacaagaagctcggcagcattgttgttataaagctcattcctactcacaaccgtattctgtttcgttataggatgggcaacaagctcaggatgatcctgaatgccattgaagtcctaattgcagagatgaatgcctttaggtttaagttccgaccagagccaccaatgtcctccatcaaatggagaaagacggattctaaaatctccaacctttctatggacattgccaacaagtcaagaaagaaagacaaagaggagattgtcaatcgattgcttgctcaagccagcaatggggatctcactgttattcccattgtaggaatgggggggatgggcaagaccaccttagcgcagctcgtttacaatgaccctgaaattcagaagcattttcagttgctgctctggttgtgtgtctctgacaacttcgatgtggattcgctggcaaaaagaatagttgaagcagctcccaaagaaatgaataagaagaatgataatggaggggccaaaaagttaccacaggatgaacttaaagaagttgtgagtgggcagaggtacctcctcattttggatgatgtctggaaccgtgatgccagtaagtgggaagcactcaagtacaaccttaagcatggtggcagcggtagctcagttttgacaacaactcgtgatcaagcagttgctcaactaatggctccagctcaagaagtttatgatctcaagaacctgaatgaaagcttcattgaggaaattatcaagagaagtgctttcaattcagaacaagaaaggcctcctcctgagctactcgaaatggttggtgatattgccaagaaatgttctggttcccctttagctgcaacagcattgggctctacactgcgtacgaagaccaccaagaaagaatgggacgctatattgagcagaagcacaatttgcgatgaggaaaatggaattttaccaatactcaaactcagttacaattgcttgccatcatatatgcggcaatgtttttccttctgtgctatttttcccaaggatcatgagatcgacgtggaaatgctgatccagttatggatggccaatggttttatcccggagaaacaaggagagtgccctgaaatcattggtaaaagaattttcagtgagttggtgtcaaggtcattttttcaggatgtgaaggggatcccatttgagttccatgatataaagtgctctaagattacttgtaagatccatgaccttatgcatgatgttgcacaatcttccatgggaaaagaatgcgctactatagctacagaacttagtaaaagtgatgattttccttattccgctcgccacttgtttttctcaggtgtcattttcctaaagaaagtatatccaggtatccaaacattgatatgttcctcgcaagaagaattgatacgttcctcgcgagaaatatcaaaatacagttcattgcgagctttaaagatggggggagattcattcctgaaaccaaaatatcttcatcacctgaggtatcttgatttgtcatacagtaaaattgaagcacttcctgaagacataagcatcctatatcatctgcaaacattgaacctttccatttgtgactgtctttgtcaactcccaaacggaatgaagtacatgaccgccctccgtcacttgtacactcacggatgttggaggttaaaaagcatgcctccggacctcggacacctcacttgcctacagacgcttacatgttttgtagccggttcttgctctggctgcagtgatttgggagagctgcggcagttggaccttggtggtcgactagagctaagaaaactggaaaatgtgacaaaagctgatgcaaaagcagcaaatctcggaaagaaggaaaaactgaccgaattgagcttaagatggactggtcagaagtacaaggaggcacagagtaataatcataaagaggtgctggaaggtctcacgcctcacgaggggctcaaggttctgagtatacttcactgtgggagcagtacatgtccaacatggatgaataaactgcgggacatggtgaagcttgtgttagatggttgcaaaaatctcgagaagcttcctccactgtggcagctgccagctctagaagttctttgccttgaaggactggatggtttaaattgcttgttcaactgtgacatatacacctcctttacattttgcagactgaaggagcttaccttggccagtatgagaaattttgagacatggtgggacacaaatgaggtaaaaggagaagagctgatatttcctgaggttgaaaagctgataatcaaaagttgtcctaggctaactgccttaccaaaagcgtcaaatgtgatttcagaattgtctggcggagttagcaccgtgtgtcattctgcatttccagcattgaaggaaatggaattatatggtttggatatctttcagaaatgggaggcagtcgatggaactccaagggaggaggtaacatttcctcagctttacaaattagatattagacggtgcccagagttgactactctacctgaagcaccaaagctgagagacttaaacatatatgaagtcaatcagcaaatatccctacaggcagccagcagatatattacttcattgtccagtctccacctgcatttgtcaactgatgacacagaaacagcaccggtggccaagcaacaagattcgagtgaattggtgattgaggatgagaaatggaatcataaatctcccctggaacttatggacttaactggctgcaaccttttattctcttacccaagtgcgttggctctgtggacatgttttgttcagctcctagatctgaatatttgggaagtcgatgcgcttgtcgactggccagaagaggtgttccagggcttggtttccttgaggaagttacatattcttcaatgcaagaatctgacaggactcacacaagctcgtgggcaatctacactagcaccaagtgaactcctgccacgtttggagtccctgcagatacgccgttgttattcttttgtagaggtccccaacctaccgacgtctctcaagctattacaaattacggactgccatgacctgaggtccatcatattcaatcagcagcaggatacgacgatgttggtgagtgcagaaagcttcgcacagccggacaagtcatcgttaatatcagggtccaccagcgagaccaacgatcgcgtccttccacgcctagaatctctagtaatagagtattgcaatcgtttgaaggttctccatcttcctccgtccatcaagaaattggatattgtacgctgtgaaaaacttcagtcactctcaggaaagctggatgccgttcgagcattaaatatcagctattgcgggagcttgaaatcactggaatcttgcttaggagagctcccgtcgctgcaacacctcagacttgttaattgcccaggcctggtatccttgccgaaggggcctcaagcatactcatctcttacatctcttgaaattcgttattgttctggtataaatttgcttccaccgagcctgcagcaacgtctggatgacatcgagaataaagaactagatgcctgctatgaaggtaatcttcagtttcttaaccgtgtacgatttagtggtaaaagtttcgagcgtggtgtctagaacccctagtcaaccattaatatgattatttgtacatagagtacaatgcgcattcataactcacttcttcagctgtgtcatctaaaccctttaaactttgagttgcatttgggtatctaatcgcatacaaaggaatttagtaatatctccagtagctattccttatatatgatgatctcttcctgtgattatgcttgctagtttggactatgtaattaatttttgccgggtcgactatgtaattaattgacttcatttagtcgccaagtgtggcatcatgcaattattatggcaaagctgtattagtcatgatcgaagccacttggtgaacttattcccttctactttgaaccaatactcattgatcatttccctttaagcgtttgatatggacaacactttaaattcgcagagctaactaacgcagcgcttgtctttacatttctttcttttctatatggtatataagggtagaatggtaatttcattcataccgctgcatgcgaggatgacttgacatactcatgtggcatttttgtgggtccaaggactatattaacccaaataattaatttgaaggacttgtttggacgatttgaaacatcgatgactaaattgagcccgaagagaaacttcaggagtcgcattggatattcacccctatatattcaatacatataaattttcttttcttttgtttgccagaatcagaggcaaaaccagaaccaaagtctcctcatcgtcaatctgcaatcagtaggctgctgtgcttggagtagcagtttcaggaccaaatgagagttgtcatcatggtttgtaacgcgtgcttgatgattgatttcgaatgaaattctagccactatccttatgcttactctctctatggtgtgacttccttgtaggatcgttaccgaatctgcaattgttgggttattaattgtgtgattgtatctcatggtagaatgtattacctacctaccttttctcaagataaactccactaaagtcgatcttctgtttggtgttgttgagttgtggtccaaatttatttgcacttaataaatgccagcttctgccgtagcggagcggaggcccgtcgtcgggaggcttgggctggagcgtcgccgggaggcctgcccgtcatcccttttagagttccaccatatatatacctcttgtaagccgccttacggcgatgtaacctcacctcagatatagtaaagatattttgctggctggc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0848700, RefSeq:Os03g0848700