Difference between revisions of "Os09g0456800"

From RiceWiki
Jump to: navigation, search
(References)
(Expression)
Line 11: Line 11:
 
Please input expression information here.
 
Please input expression information here.
  
Chuang wang[7] detected the expression patterns of OsHsfs in rice. They found The majority of OsHsf genes had a low to moderate level in most tissues, while some displayed a tissue-specific manner (Fig.1). For example HsfB1, than other genes has a relative heavy level in the tissues of root and seed. Chuang wang also studied the Cis-acting elements in OsHsf promoters. They found 9 different Cis-acting elements in total. One of the Cis-acting element,ARE and GC-motif involved in the anaerobic induction, has a high number of 4 in the HsfB1.  We can suppose that the high level of HsfB1 in seed and root and the high level of ARE and GC-motif are adaptive to the environment for rice.
+
Chuang wang[7] detect the expression patterns of OsHsfs in rice. They find the majority of OsHsf genes have a low to moderate level in most tissues, while some display a tissue-specific manner (Fig.1). For example HsfB1, than other genes has a relative heavy level in the tissues of root and seed. Chuang wang also studys the Cis-acting elements in OsHsf promoters. They find 9 different Cis-acting elements in total. One of the Cis-acting element,ARE and GC-motif involved in the anaerobic induction, has a high number of 4 in the HsfB1.  We can suppose that the high level of HsfB1 in seed and root and the high level of ARE and GC-motif are adaptive to the environment for rice.
 
[[File:123.jpg]]
 
[[File:123.jpg]]
  

Revision as of 12:12, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Heat stress transcription factors (Hsfs) are the central regulators of defense response to heat stress. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to their protein structures[1]. HsfB1 is one gene of the HsfB which consists of 8 genes. plant Hsfs diversify in their biological functions[2][3]. HsfA members are capable of transcriptional activation, while HsfB members act as repressors or as co-activators (e.g., HsfB1) of HsfA members. Overexpression of Hsf genes in transgenic plants resulted in an up-regulation of heat stress-associated genes and an enhancement of thermotolerance, whereas the down-regulation of Hsf genes leads to a reduction in the thermotolerance[4][5]. In addition to control of heat stress response, Hsfs have also been reported to be involved in the defense response to pathogen attack, oxidative stress, heavy metals, dehydration and salinity, and in certain processes of development and differentiation[6].

Expression

Please input expression information here.

Chuang wang[7] detect the expression patterns of OsHsfs in rice. They find the majority of OsHsf genes have a low to moderate level in most tissues, while some display a tissue-specific manner (Fig.1). For example HsfB1, than other genes has a relative heavy level in the tissues of root and seed. Chuang wang also studys the Cis-acting elements in OsHsf promoters. They find 9 different Cis-acting elements in total. One of the Cis-acting element,ARE and GC-motif involved in the anaerobic induction, has a high number of 4 in the HsfB1. We can suppose that the high level of HsfB1 in seed and root and the high level of ARE and GC-motif are adaptive to the environment for rice. 123.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Chuang wang[7] construct neighbor-joining phylogenetic trees(fig.2) to determine the phylogenetic relationship among the OsHsfs. AtHsf stand for Arabidopsis Hsf, which is used to classify rice Hsfs.

234.jpg

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

1 Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A., Scharf, K.D., 2001. Arabidopsisand the heat stress tran scription factor world: how many heat stress transcription factors do we need? Cell Stress Chaperones, 6(3): 177-189.

2 Kotak, S., Larkindale, J., Lee, U., von Koskull-Döring, P., Vierling, E., Scharf, K.D., 2007a. Complexity of the heat stress response in plants. Curr. Opin. Plant Biol., 10(3): 310-316.

3 von Koskull-Döring, P., Scharf, K.D., Nover, L., 2007. The diversity of plant heat stress transcription factors. Trends Plant Sci., 12(10):452-457.

4 Charng, Y.Y., Liu, H.C., Liu, N.Y., Chi, W.T., Wang, C.N., Chang, S.H., Wang, T.T., 2007. A heat-inducible transcription factor, HsfA2, is required for extension of acquired thermotolerance in Arabidopsis. Plant Physiol., 143(1):251-262.

5 Mishra, S.K., Tripp, J., Winkelhaus, S., Tschiersch, B., Theres, K., Nover, L., Scharf, K.D., 2002. In the complex family of heat stress transcription factors, HsfA1 has a unique role as master regulator of thermotolerance in tomato. Genes Dev., 16(12):1555-1567.

6 Larkindale, J., Hall, J.D., Knight, M.R., Vierling, E., 2005. Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance. Plant Physiol., 138(2):882-897.

7 Chuang WANG, Qian ZHANG, Hui-xia SHOU. Identification and expression analysis of OsHsfs in rice. Journal of Zhejiang University SCIENCE B 2009 10(4):291-300.

Structured Information

Gene Name

Os09g0456800

Description

Similar to Heat stress transcription factor Spl7 (Heat shock transcription factor) (Heat shock factor RHSF10)

Version

NM_001069899.1 GI:115479540 GeneID:4347259

Length

7445 bp

Definition

Oryza sativa Japonica Group Os09g0456800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:17875190..17882634

Sequence Coding Region

17875536..17875802,17881683..17882324

Expression

GEO Profiles:Os09g0456800

Genome Context

<gbrowseImage1> name=NC_008402:17875190..17882634 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:17875190..17882634 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctgctgctgaggcggcggcggcggtggggaagcagcagcagaagggcggcgggggaaggggaggaggcggcggtgggccggcgccgttcctgacgaagacgaaccagatggtggaggagagcgcgacggacgaggtgatctcgtggggaaaggaggggcggtcgttcgtggtgtggaagccggtggagttcgcccgcgacctcctcccgctccacttcaagcactgcaacttctcctccttcgtccgccagctcaacacctacggtttccggaaggtggtgcccgatcggtgggagttcgccaacggcaacttccggcgaggagagcaaggcctcctctccggcatccgccgccgcaaggcgacgacgcctcagtcctccaaatcctgcggcagcggcgtcaacgtcgcgttccctccgccgctgccccctctgcccccggagccgtcggcgaccacgtccagcggcaacgaccgcagctcctcctccgcgtcctcgccgccgcgggcggacatcaccagcgagaacgagcagctcaggaaggacaaccaaacgctgacgatggagctggcgcgggctcggcggcactgcgaggagcttctgggcttcctgtcgcgcttcctcgacgtccggcagctcgatctccggctgctcatgcaggaagacatgcgagcggcggccggcggcgtcggcggcgagcagcgcgtgcaagagcacgcccgggaggagaagtgcgtgaagctgttcggcgtgctcctcgacgacacccatggcgccgccacgaggaagagggcgcggtgcgaggaggcggctgccagcgagcggccgatcaagatgatcaggatcggcgagccgtgggtcagcgttccatcgtcggggccggcgcggtgtggcggcgacaactga</cdnaseq>

Protein Sequence

<aaseq>MAAAEAAAAVGKQQQKGGGGRGGGGGGPAPFLTKTNQMVEESAT DEVISWGKEGRSFVVWKPVEFARDLLPLHFKHCNFSSFVRQLNTYGFRKVVPDRWEFA NGNFRRGEQGLLSGIRRRKATTPQSSKSCGSGVNVAFPPPLPPLPPEPSATTSSGNDR SSSSASSPPRADITSENEQLRKDNQTLTMELARARRHCEELLGFLSRFLDVRQLDLRL LMQEDMRAAAGGVGGEQRVQEHAREEKCVKLFGVLLDDTHGAATRKRARCEEAAASER PIKMIRIGEPWVSVPSSGPARCGGDN</aaseq>

Gene Sequence

<dnaseqindica>347..613#6494..7135#aagcggaggtccggaggaggaagcggcgagagaagctcagctaggcagggcgacgggcagaaacgcgaccacggcaacaaaccccgccgcgcgcgcccaccgtgccggttacatgggagtagaggcgggcggcggctgcggtgggagggcggtagtcaccggattctacgtctggggctgggagttcctcaccgccctcctgctcttctcggccaccacctcctactagctatacacacccatctcaccataacacacatacatagatagatagatagatagatacatacacacaaacataagtagctaggtagagaaagagatcatagcgttaggtgatcgatcgatggctgctgctgaggcggcggcggcggtggggaagcagcagcagaagggcggcgggggaaggggaggaggcggcggtgggccggcgccgttcctgacgaagacgaaccagatggtggaggagagcgcgacggacgaggtgatctcgtggggaaaggaggggcggtcgttcgtggtgtggaagccggtggagttcgcccgcgacctcctcccgctccacttcaagcactgcaacttctcctccttcgtccgccagctcaacacctacgtacgtacacattacacacactcgatctcttgctccatctcgatactcgatctcctaactttgttgatttgatcatcatatcatcatcctgcactgcatgcgtacgtcgaataattcctgtatctgcgttctgtattcaactgcaggacgccttgaacggcgtccttttgggttagatgacgatgtacttgcagggttgacgtttcttgtctgtgggcgagctttcgctgtcgtggccgagctgtgttcattacgtttccatagttgtctacacgtatgtacgctggtgttttctgacttatatataagggaaatttggaaccatgtcattataattttgcaaaatttgagatatgccatcggtatctcaatgacatgtgggtcaagatggcatatctcaaattttgcaaaattataatggcatggttccaattttccctatatataactcgccttaccaagttgccgtttatagcatttggctatctttttagttcttcttggcgaaatcatatcctactctagcttgcttgtgatatcggttttgttagggaaacaagtaacatgtggttactgaatactccatttgaggctttaagctcaccaaaagcatgagcctacaaggatacggagtaaaggctagctcgtcaatttgttggttcatctatcccgttctagaatctagcagaaactgaaatagccaaatgtgtatgcatgaccacctgttgctagctgcacatgtttctttggtcattgtggggccatggagttagcttgttaagcagttcagaactttccatttgtgccgttcggtcatatatgcccctcaacaaaattaattagctagtgaataattagttgaatgaaacatctggagctagccaaccaattaagctagctgagctaatttgttaggcaaattaatcttgattcgcttctggactgccggaagaggaagaagaagctagctaggcagactccaatcggtctgtacactgtagtcgacctaaagcgtagaaaaggaggtttcttgtcgtgttacacgatcataaactgaatatctgaactgacctttgaggcaaaaatggacaacagggttagatacgtgtgtcagggagtgtgcgccattcggaagtcaattgatctctccacttcgttttagttttccacgcaaagcatgcttatcggttttaaacgacggattcaacctgccttaagaaagataattgggggcagaaagagacaatagaatgatagaaacgattgaaaagagagatgcacctactgctagctgacgtgttcatcatctttttttttccatttctcccttttgacaaaaacctcacgtctgttgtgtagtcaattcgtcagaagttaattccactttactgatgatcttgcatcagaaaacaagaagatcacatagctataaaccacaactctgaaattataaatagcaggtggaaccacaaatctgaaacggcagaggtcatcttcttccattgaaaaaaaaaaggaaaaaaaaagatgaagtgcgatgaagacaaccatgtacgtaagcaagtgtactccattgctgaatgcttcaaagaggaaactctagcatcatgcatatgcatctgagcatctcgaagatgaccatttccaattactattagctagctcgttgtgaaagggcatatagtctagtggttgcggtgacctaaatagcaccctaaggtattgagttcaaatctctataggagtgaatttcagattgggttatttgagggctagcaccccaaagttctgagttcaaatctcgatagtagcgaatttcagattgggttatttgagggctagcacaccaaggttctgagttcaaatctccatagaagcgaatttcagattagattatttgaggactaggtttctatatttgataggctaagttcctaattaaaaatatatttgataggctaagtttctaattaaaaagaggctgtatatatctggttgaatatagagggctggtaaaaaaatacctcgtctactagaagggtgttcatatctgaactggcaaaaggaaaggacacgtcgcgactagcaaattgcgacgggagcaaagtagcaaacagttccatgaaagcaaagttaattaggtaactgatatatagtagcttgcagatcaggcataattcaggccggccgtcgattgacacgccaagtgtactagtggcgacaaagcatgatttctggtgcatctctatgattatatacgggacaggaatcttggtggaaatttctgggatggattgacttttccgggctcttcgtctatgatcgtctagaaatgttggcacttgttgtaccgtactcaacctgcacatgcaaagcatccagcgcagctaatctttgtttgcctttactcgtgttcgtgcttaatttgtggggtagaaagtttcttcagcgaacatgtcgtgtgtggtttctcctgtgcttgatcacaacatcacaggatcttggacctttggtgcatgaatactgacatgcatgttcatcagtactatagttatagttgtcaaagcgtcacgctaataacaacaagctatttatatcttcaaaagaaaaaaaaaacaagatcagctatctagctcagttctcagtactggttcttcaattgctgcaactggagtagatgagaatactccaaagtgtgaacgtctaatagtattgattagcagcgacgtctgacagagatgtataacaagtatcctgacgtctggtatattgaattcaatggaacagttgagttactctttccgttgtgattgattctgcacatcttgtggtgttgttcgaatttgacttctagtagaaatttgatcttaggatctgtcagtgagacagtgatatatccatcatgttttttttagatgacatccttcttgttttagcacccaacattcatgatatttgcttccctttgatatactgttcttcaagcgttaatccttgaatatactccctccgtttcatattataaatcgtttaacttttttctaatcaaactttattaagtttgacctagtttatagaaaaatttgatagtattatcagcacaaaacaaatatattatcaaaatatattcaagatttaatgagtattaagatggttttttgttccgatcaaacatttaatttagtttagtaagtcagatgcatggaaactacaaatataactaattggaaaaaacaaaaatataaaataagtctaacgcttttggatggagagagtagataatataaatgctgcagaatgactgcagagagtggaagttgtcacctatggcctcgtttagacgggccttaaatctgtccatctacgtatatggccgagtgtttgaactaaactagttgggtggcccgcgcaattgcgcagctagtatccatacaaaattatcttcttttatatatgattttacttaaaatttgttaaataactatctcgttgtcttaggactttaaaagaccgaaccttaaaatctccatgtttctaattttgtagttttaaaaagtcacaccactcactacctcttacctctttgtcaccccctttatttgtttgcttatctactacagcttctatttatcctccttggaactttaaaattgaaccttataaattttagagttaattaaatcgttggttttcattttttaattctcgtcaaatgccgctactctactcctctacggcccgtccaccgcttcctctctttattgttattgagattttaacaatcgaacacaattatcgccagtgttcatttttaactttctaaaagtcccgccaaactgtcagcagcattgccattatactcttgtacggcccgtcctatgcctttccttttaattatcattgagattttaaaaattgaacgtgattatcattgtggtttatttttttactttctagaagtcccgccgatcactctgattgtgcttcttaacgggttgcccgccatctctcctcttaatcgccattggaattttatttggggttttgtttatactttttacgcccattgccttccctcttttttattattgagattttacaaatcaaatatgattttcattggagtttattttttactttctagaagtcccaccaacccccgtgatcatgctattacaatggcctgtccattgtccctcgtcttaattgtcattggattctattttaggttttgtttatagtttttagatgtcccatcaaccactgccaccctactcctttacagtctcgttgcttctccgctctttattttcatttgccatcgttgtgtttttagatggattgtgttttatttccatattttttattcagatattatgttgtttataaattttattcctacttgaacgcctttaattgtttttaaatttttagaatttaatttattttttattccaaaatttaattaaactcgtgctctagatgatctcttctttcagtattgcttattttttattccgaattttagttattttaaattgtatgcccatatgaactcttatttttattttctaactttagaatttagtttggtgatgggttgctctttcaatattcctttttgttaatttcgaatttgagttatttctaaattgtaatcctacttataatatctttttttgtaatttcagaatttattttattttatttttcattccaacatttaattaatcttgtgttgtgttttgaatggcctattctttcaatatcctaacttattattccaaattgataattctaggcttatagagttctgaactgcatgttttcaaagtatggttcatggatggattgttgatttggttaggacatggtatttcttagtactctcagttttttttaactaaccaatatcatataaaaaaatataggagtatttttttataaaaatattgacatatataggctttctagcatttatgattagaaacttgagaggaaagagaacccatctatatatgtgtatttgaaaattagcatgtggtagtcaataaaaacttattgtaattatattagagaataggattactgctaaaagttttagcttttcatttgaatccgatggaggacttgtcctgtcctgtttttcctgtcctgttgctagaccttcatagctatgattccaaaaaaaacgtgtcatgttgttgtgtggctttgctcggttgggagtccgactgcaaacatgactatgagaaggacatgtatactgcgtagtattttttttctttatttatatacctatacaatcaatcttaaccgttataatatagatccactatgagaatatatttttctttttatttcaaattttaattaatctcgtattggatttatagatggactcttattttaattttacttatttttaattccgaatttcaattattcttagattgtacttctatttggactcttcttttctttttcttcgattaacgtggtaatttctaggcctctacggtgaacgtggtgcctctttttcgaactgttttaataatataatagataggtagatagatagattcttggcccacagatatagatgggccggattaaactgttttgcacgtagttgtctatgaacaaagaatatcccaaatctaagcatttatgccaaattttcattgttgattgtacatttgtacttgtgcattcaccgaattaacgatgtgtgataacaaacacgttcttagtgtctttctgccaaaaacatgtccttattgtcttgtgttgattaggacagaaacatgttacgattgcccctcaatacgttcacacgatctgaccggggctaacgagagatggcgactattcatgcagggtttccggaaggtggtgcccgatcggtgggagttcgccaacggcaacttccggcgaggagagcaaggcctcctctccggcatccgccgccgcaaggcgacgacgcctcagtcctccaaatcctgcggcagcggcgtcaacgtcgcgttccctccgccgctgccccctctgcccccggagccgtcggcgaccacgtccagcggcaacgaccgcagctcctcctccgcgtcctcgccgccgcgggcggacatcaccagcgagaacgagcagctcaggaaggacaaccaaacgctgacgatggagctggcgcgggctcggcggcactgcgaggagcttctgggcttcctgtcgcgcttcctcgacgtccggcagctcgatctccggctgctcatgcaggaagacatgcgagcggcggccggcggcgtcggcggcgagcagcgcgtgcaagagcacgcccgggaggagaagtgcgtgaagctgttcggcgtgctcctcgacgacacccatggcgccgccacgaggaagagggcgcggtgcgaggaggcggctgccagcgagcggccgatcaagatgatcaggatcggcgagccgtgggtcagcgttccatcgtcggggccggcgcggtgtggcggcgacaactgaagtccaaacttgtgcatgccacggccatgacctgatcgaccaggcgaacggcaagcagaaggcatgcatggtgaggttggtggcaagaatggtccgatcaaccaagtcattaggtaaaacgagacgaattaagcacgccaaatacgtgcggccctgtgttaatcacgggttgctaccatgctagtagtaaggtaggaacagtacgaggagtcaaggctgaccgaagcgaagcagccggctcttgtgtctggacgttgtttcagttaacactgaaagcttcaccttactatggattatacattttttagat</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0456800, RefSeq:Os09g0456800