Difference between revisions of "Os10g0148000"

From RiceWiki
Jump to: navigation, search
Line 7: Line 7:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
OsDIL (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.
 +
dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family (Fig. S2A).
 +
 
  
 
===Evolution===
 
===Evolution===

Revision as of 13:45, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.plays a role in drought tolerance at vegetative and reproductive stages

Expression

OsDIL (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family (Fig. S2A).


Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0148000

Description

Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein

Version

NM_001070697.2 GI:297610101 GeneID:4348109

Length

1111 bp

Definition

Oryza sativa Japonica Group Os10g0148000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:2864478..2865588

Sequence Coding Region

2864524..2864871

Expression

GEO Profiles:Os10g0148000

Genome Context

<gbrowseImage1> name=NC_008403:2864478..2865588 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:2864478..2865588 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga</cdnaseq>

Protein Sequence

<aaseq>MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH</aaseq>

Gene Sequence

<dnaseqindica>47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0148000, RefSeq:Os10g0148000