Difference between revisions of "Os07g0549600"

From RiceWiki
Jump to: navigation, search
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
The tapetum, the innermost of four sporophytic layers in the anther wall, comes in direct contact with the developing male gametophyte and is thought to play a crucial role in the development and maturation of microspores. This gene is required for the differentiation of secondary parietal cells to mature tapetal cells and plays a major role in maintaining tapetum development, starting in early meiosis. The transcript is preferentially present in all cell types within the early anthers. This gene is a Major Regulator of Early Anther Development and at the molecular level the meiocyte development is regulated by this gene[1].
  
 
===Expression===
 
===Expression===

Revision as of 15:08, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. The tapetum, the innermost of four sporophytic layers in the anther wall, comes in direct contact with the developing male gametophyte and is thought to play a crucial role in the development and maturation of microspores. This gene is required for the differentiation of secondary parietal cells to mature tapetal cells and plays a major role in maintaining tapetum development, starting in early meiosis. The transcript is preferentially present in all cell types within the early anthers. This gene is a Major Regulator of Early Anther Development and at the molecular level the meiocyte development is regulated by this gene[1].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0549600

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001188319.1 GI:297725768 GeneID:9269572

Length

1698 bp

Definition

Oryza sativa Japonica Group Os07g0549600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:22474472..22476169

Sequence Coding Region

22474473..22474668,22474893..22475089

Expression

GEO Profiles:Os07g0549600

Genome Context

<gbrowseImage1> name=NC_008400:22474472..22476169 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:22474472..22476169 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gtcctgaatttcggtggaggtggtgggggagaggaggacggcgacgacggggaggaggagcagcagcagcagcaggcggcggcggcggcgatggggaaggagttcaagtccaagaacctggaggccgagcggcggaggagggggaggctcaacggcaacatcttcgcgctcagggcggtcgtgcccaagatcaccaagatgagcaaggaggccaccttgtcggacgcgatcgaacacatcaagaatctccagaacgaggttcttgagctgcagcgccagctcggcgactcacccggtgaggcttgggagaagcaatgcagcgcgtcctgctctgaatccttcgtccccactgagaacgcccattatcaggtagcagccgctgttctcaagtag</cdnaseq>

Protein Sequence

<aaseq>VLNFGGGGGGEEDGDDGEEEQQQQQAAAAAMGKEFKSKNLEAER RRRGRLNGNIFALRAVVPKITKMSKEATLSDAIEHIKNLQNEVLELQRQLGDSPGEAW EKQCSASCSESFVPTENAHYQVAAAVLK</aaseq>

Gene Sequence

<dnaseqindica>2..197#422..618#ggtcctgaatttcggtggaggtggtgggggagaggaggacggcgacgacggggaggaggagcagcagcagcagcaggcggcggcggcggcgatggggaaggagttcaagtccaagaacctggaggccgagcggcggaggagggggaggctcaacggcaacatcttcgcgctcagggcggtcgtgcccaagatcaccaaggcaaatgcattcttgagcttcctccccacttttactgaccaccaccagctgattcttgcactgatcatacaaacttcgcataatcagatatgaacctgtttatacttacctaaccctctctcgattctctggaaatcgtgattgcttcaccggggaaaggatttcttgattccggtttgtcattcctgacatgttctgatggttggttttctctgctgttgcagatgagcaaggaggccaccttgtcggacgcgatcgaacacatcaagaatctccagaacgaggttcttgagctgcagcgccagctcggcgactcacccggtgaggcttgggagaagcaatgcagcgcgtcctgctctgaatccttcgtccccactgagaacgcccattatcaggtagcagccgctgttctcaagtagtctatgttttccatcaaagttcacacttcagagagtagtggtctgtactctttagaaccccactgtgcgtccctgggactaattctgaacaaccaatgctgcaatctggaaaatatgatcactcaacttcatacaactttaggcccagattgtttcacaattcgattacatgaagtcgcagtctcgcagacaattggcagatatttgaagctccttaacctttttcgcttaatagacaataaacacacctgaagaagggtgaaaaatctaatccttatttggtttagtagactaatgtccaacttcattgatccacagttagactagccatggacttttgtgagaatttttcaacttacattcagacagagcttgatctcagaaatgacttaacatgaacacaaaaaatattggatacagattcatctatttttctgtgacaaaatttacctctgatatctgattcctcagtctctcaacaatctacatttacacagggtcaggtggaattgatctctcttgggtcatgcaagtataacctgaagatcttctggaccaagagggcaggcctcttcaccaaggtgctggaagcactctgcagctacaaagtgcaagtgctcagcctgaacaccatatccttctacggctacgcagagagtttcttcaccatcgaggtaaactaaatatggccaaaattttcctgctacgacacaagattgcattgcatgtagatttcgctgaactttttaacccattcttgtgagttttagtcttctgataagttggccactcactcctgtctccatctgcaggtgaagggtgagcaggatgttgtgatggtggagctgaggagccttctctccagcattgtggaggttccaagcatctgagacactcctgactacaataaactcacatgactcatgttaagagagcacatatgtttctctggaagaaataattccagtagcagttctctttgtagggagaatacagtggtacatgtttgactgaatgactgatgacatagaagggggaaaaaaggactaaattttgtgttgaaattgagcacagtggcac</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0549600, RefSeq:Os07g0549600