Difference between revisions of "BGIOSGA019069"
(→Evolution) |
(→Function) |
||
| Line 4: | Line 4: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | WOX3 funtions as a transcriptional repressor of YAB3. | |
| + | |||
| + | The YABBY family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. YABBY members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize FIL-related YABBY genes(ZmYAB9 and ZmYAB14) expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice YABBY genes have different funtions from YABBY members in Arabidopsis and in maize. Additionally, these rice YABBY genes have distinct funtiions. In particular, YAB3 contributes to the exclusion of KNOX expression from the leaves(KNOX genes are essencial for leaf development), that is YAB3 is required for the promotion of diffentiation during leaf organogenesis. | ||
| + | |||
| + | Transgenetic experiments show that overexpression of WOX3 represses YAB3 and repression of WOX3 by RNAi | ||
===Expression=== | ===Expression=== | ||
Revision as of 15:15, 25 May 2014
Please input one-sentence summary here.
WOX3, a rice WUSCHEL-LIKE HOMEOBOX gene, negatively regulates the rice YAB3 gene which is involved in the leaf development in rice.
Contents
Annotated Information
Function
WOX3 funtions as a transcriptional repressor of YAB3.
The YABBY family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. YABBY members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize FIL-related YABBY genes(ZmYAB9 and ZmYAB14) expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice YABBY genes have different funtions from YABBY members in Arabidopsis and in maize. Additionally, these rice YABBY genes have distinct funtiions. In particular, YAB3 contributes to the exclusion of KNOX expression from the leaves(KNOX genes are essencial for leaf development), that is YAB3 is required for the promotion of diffentiation during leaf organogenesis.
Transgenetic experiments show that overexpression of WOX3 represses YAB3 and repression of WOX3 by RNAi
Expression
Please input expression information here.he
Evolution
According to the phylogeny analysis of YABBY and WOX families, OsWOX3 is highly homologous to Arabidopsis PRS gene and the maize dulicated NS1 and NS2 genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA019069 |
|---|---|
| Description |
Putative wuschel homeobox protein |
| Definition |
Oryza sativa Indica Group BGIOSGA019069, complete gene. |
| LocusTag |
WOX3 |
| Ensembl Transcript ID |
BGIOSGA019069-TA |
| Ensembl Protein ID |
BGIOSGA019069-PA |
| Length |
941 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:1033323..1034263 |
| Sequence Coding Region |
1033323..1033910,1033991..1034263 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome05:1033323..1034263 source=RiceIndica05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome05:1033323..1034263 source=RiceIndica05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG</cdnaseq> |
| Protein Sequence |
<aaseq>MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV</aaseq> |
| Gene Sequence |
<dnaseqindica>1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG</dnaseqindica> |
| External Link(s) |
