Difference between revisions of "Os01g0667400"
(→Annotated Information) |
(→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). | + | DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). |
| + | |||
| + | DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). Most dwt1 mutant plants develop main shoots with normal height and larger panicles, but dwarf tillers bearing smaller panicles compared with those of the wild type. In addition, dwt1 tillers have shorter internodes with fewer and un-elongated cells compared with the wild type, indicating that DWT1 affects cell division and cell elongation. Map-based cloning revealed that DWT1 encodes a WUSCHEL-related homeobox (WOX) transcription factor homologous to the Arabidopsis WOX8 and WOX9. The DWT1 gene is highly expressed in young panicles, but undetectable in the internodes, suggesting that DWT1 expression is spatially or temporally separated from its effect on the internode growth. Transcriptomic analysis revealed altered expression of genes involved in cell division and cell elongation, cytokinin/gibberellin homeostasis and signaling in dwt1 shorter internodes. Moreover, the non-elongating internodes of dwt1 are insensitive to exogenous gibberellin (GA) treatment, and some of the slender rice1 (slr1) dwt1 double mutant exhibits defective internodes similar to the dwt1 single mutant, suggesting that the DWT1 activity in the internode elongation is directly or indirectly associated with GA signaling. This study reveals a genetic pathway synchronizing the development of tillers and the main shoot, and a new function of WOX genes in balancing branch growth in rice. | ||
| + | |||
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
Revision as of 03:40, 26 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa).
DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). Most dwt1 mutant plants develop main shoots with normal height and larger panicles, but dwarf tillers bearing smaller panicles compared with those of the wild type. In addition, dwt1 tillers have shorter internodes with fewer and un-elongated cells compared with the wild type, indicating that DWT1 affects cell division and cell elongation. Map-based cloning revealed that DWT1 encodes a WUSCHEL-related homeobox (WOX) transcription factor homologous to the Arabidopsis WOX8 and WOX9. The DWT1 gene is highly expressed in young panicles, but undetectable in the internodes, suggesting that DWT1 expression is spatially or temporally separated from its effect on the internode growth. Transcriptomic analysis revealed altered expression of genes involved in cell division and cell elongation, cytokinin/gibberellin homeostasis and signaling in dwt1 shorter internodes. Moreover, the non-elongating internodes of dwt1 are insensitive to exogenous gibberellin (GA) treatment, and some of the slender rice1 (slr1) dwt1 double mutant exhibits defective internodes similar to the dwt1 single mutant, suggesting that the DWT1 activity in the internode elongation is directly or indirectly associated with GA signaling. This study reveals a genetic pathway synchronizing the development of tillers and the main shoot, and a new function of WOX genes in balancing branch growth in rice.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. Wenfei Wang;Gang Li;Jun Zhao;Huangwei Chu;Wenhui Lin;Dabing Zhang;Zhiyong Wang;Wanqi Liang
DWARF TILLER1, a WUSCHEL-Related Homeobox Transcription Factor, Is Required for Tiller Growth in Rice PLoS Genetics, 2014, 10(3): e1004154
2. Wenfei Wang;Huangwei Chu;Dabing Zhang;Wanqi Liang
Fine Mapping and Analysis of DWARF TILLER1 in Controlling Rice Architecture Journal of genetics and genomics, 2013, 40(9): 493-495
Structured Information
| Gene Name |
Os01g0667400 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001050343.1 GI:115439056 GeneID:4326320 |
| Length |
1538 bp |
| Definition |
Oryza sativa Japonica Group Os01g0667400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:29046116..29047653 |
| Sequence Coding Region |
29046806..29047498 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:29046116..29047653 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:29046116..29047653 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtccgtgacgacggccatggacctgctctcgccgctcgccgcggcgtgccaccagcagatgctctatcaaggccagccactggagtcgccgccggcgcctgctcccaaagtgcacggcatcgtgccacacgacgagccggtcttcctgcagtggccgcagagcccctgcctgtcggccgtcgacctcggcgccgccattcttggcggccagtacatgcacctgccggtgcccgctccgcagccaccgtcgtcgccgggcgcggcgggcatgttctgggggctctgcaacgacgtgcaagcgccaaacaacaccggccacaagagctgcgcctggagcgccgggctcggccagcactggtgcggctccgccgatcagctcggcctcggcaagagcagcgcggcgtcgatcgccaccgtgtctaggccggaggaggcgcacgacgtcgacgccacgaagcacggtctgctacagtacggctttggcatcaccacgccgcaagtgcacgtggacgttacctcctcggctgctggcgttctgcctcctgttccgtcctcgccgtcgccgccgaacgccgccgtcaccgtcgcgagcgtggccgccaccgctagcctgactgattttgctgcaagtgctatatctgctggcgccgtcgctaacaatcagtttcaaggtactctttttgttctttga</cdnaseq> |
| Protein Sequence |
<aaseq>MSVTTAMDLLSPLAAACHQQMLYQGQPLESPPAPAPKVHGIVPH DEPVFLQWPQSPCLSAVDLGAAILGGQYMHLPVPAPQPPSSPGAAGMFWGLCNDVQAP NNTGHKSCAWSAGLGQHWCGSADQLGLGKSSAASIATVSRPEEAHDVDATKHGLLQYG FGITTPQVHVDVTSSAAGVLPPVPSSPSPPNAAVTVASVAATASLTDFAASAISAGAV ANNQFQGTLFVL</aaseq> |
| Gene Sequence |
<dnaseqindica>156..848#tcacgccgccgccaccaatcctcccggcgccccagccggtgcagccgcagcagcagcttgtctcgcctgtggcggcgcctacctcgtcgtcgtcttcctcctccgaccgttcgtccgggtccagcaagcctgcgagggctacgtcgacgcaggcgatgtccgtgacgacggccatggacctgctctcgccgctcgccgcggcgtgccaccagcagatgctctatcaaggccagccactggagtcgccgccggcgcctgctcccaaagtgcacggcatcgtgccacacgacgagccggtcttcctgcagtggccgcagagcccctgcctgtcggccgtcgacctcggcgccgccattcttggcggccagtacatgcacctgccggtgcccgctccgcagccaccgtcgtcgccgggcgcggcgggcatgttctgggggctctgcaacgacgtgcaagcgccaaacaacaccggccacaagagctgcgcctggagcgccgggctcggccagcactggtgcggctccgccgatcagctcggcctcggcaagagcagcgcggcgtcgatcgccaccgtgtctaggccggaggaggcgcacgacgtcgacgccacgaagcacggtctgctacagtacggctttggcatcaccacgccgcaagtgcacgtggacgttacctcctcggctgctggcgttctgcctcctgttccgtcctcgccgtcgccgccgaacgccgccgtcaccgtcgcgagcgtggccgccaccgctagcctgactgattttgctgcaagtgctatatctgctggcgccgtcgctaacaatcagtttcaaggtactctttttgttctttgatatgaagaatttaattaactggtcaaatcatgaatcaccaccatttagctagattatctgttggcattttttcccctttgttcagtatcacatgcatgcatcatattcatacgctcatgtttaaatggattaattagaagtgtcacttcaggggagtctaacttctcttgtagtgttgtcctcaatttcagtttcgtttggatttaactacaaaatgacaaattttttactgaaagaagaattgtatatgcatgaaattgtactgtactagtttcctttagggcccaatccaaaccagccgttctcaaacaagggccctgtgcccaggcatggcaatgataataagacaagtttaggccatgtaaaatccttttcttttgtgtgtctgtacaatcttatcacttcaatgcagatagactttccagtaaagatgaagaaatttgtcattttgtaagcatgtagatttagacaagaccaaaatttgtgagctgttctccatcaggtcaaattgagtaggtttcttgatgggatgttacaaatatgcgaactactagtactactgctatttcatggtgatggggaacatcatgtcatcgcatgtagatgcattcagctcccacatgctccctccatccaaaaaaaagacaaaccctggtttgcatgtgcaacgtttgaccgtccgtcgtattt</dnaseqindica> |
| External Link(s) |