Difference between revisions of "Os01g0667400"
(→Function) |
(→Function) |
||
| Line 7: | Line 7: | ||
DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). | DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). | ||
DWT1 mutant has no obvious morphological difference with wild-type plant at the initial vegetative stage. However, DWT1 developes dwarfed tillers with the main shoot having nearly normal height during the reproductive stage. DWT1 tillers have shorter internodes with fewer and un-elongated cells, indicating that DWT1 affects cell division and cell elongation. DWT1 encodes a WUSCHEL-related homeobox (WOX) transcription factor homologous to the Arabidopsis WOX8 and WOX9. | DWT1 mutant has no obvious morphological difference with wild-type plant at the initial vegetative stage. However, DWT1 developes dwarfed tillers with the main shoot having nearly normal height during the reproductive stage. DWT1 tillers have shorter internodes with fewer and un-elongated cells, indicating that DWT1 affects cell division and cell elongation. DWT1 encodes a WUSCHEL-related homeobox (WOX) transcription factor homologous to the Arabidopsis WOX8 and WOX9. | ||
| − | [[File:dwt1.jpg]] | + | [[File:dwt1.jpg|right|Morphology of the wild type and dwt1 plants after heading]] |
===Expression=== | ===Expression=== | ||
Revision as of 07:30, 26 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa).
DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). DWT1 mutant has no obvious morphological difference with wild-type plant at the initial vegetative stage. However, DWT1 developes dwarfed tillers with the main shoot having nearly normal height during the reproductive stage. DWT1 tillers have shorter internodes with fewer and un-elongated cells, indicating that DWT1 affects cell division and cell elongation. DWT1 encodes a WUSCHEL-related homeobox (WOX) transcription factor homologous to the Arabidopsis WOX8 and WOX9.
Expression
The DWT1 gene is highly expressed in young panicles, but undetectable in the internodes, suggesting that DWT1 expression is spatially or temporally separated from its effect on the internode growth. Altered expression of genes involved in cell division and cell elongation, cytokinin/gibberellin homeostasis and signaling have been revealed in DWT1 shorter internodes. Previous reports indicated no effect of these hormonal pathways on the coordination between the tiller and the main shoot growth, but latest resoults reveals that the DWT1 activity is directly or indirectly associated with GA signaling in the internode elongation.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1 State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai, China
2 Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing, China
3 Graduate University of the Chinese Academy of Sciences, Beijing, China
4 Department of Plant Biology, Carnegie Institution for Science, Stanford, California, United States of America
References
1. Wenfei Wang;Gang Li;Jun Zhao;Huangwei Chu;Wenhui Lin;Dabing Zhang;Zhiyong Wang;Wanqi Liang
DWARF TILLER1, a WUSCHEL-Related Homeobox Transcription Factor, Is Required for Tiller Growth in Rice PLoS Genetics, 2014, 10(3): e1004154
2. Wenfei Wang;Huangwei Chu;Dabing Zhang;Wanqi Liang
Fine Mapping and Analysis of DWARF TILLER1 in Controlling Rice Architecture Journal of genetics and genomics, 2013, 40(9): 493-495
Structured Information
| Gene Name |
Os01g0667400 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001050343.1 GI:115439056 GeneID:4326320 |
| Length |
1538 bp |
| Definition |
Oryza sativa Japonica Group Os01g0667400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:29046116..29047653 |
| Sequence Coding Region |
29046806..29047498 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:29046116..29047653 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:29046116..29047653 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtccgtgacgacggccatggacctgctctcgccgctcgccgcggcgtgccaccagcagatgctctatcaaggccagccactggagtcgccgccggcgcctgctcccaaagtgcacggcatcgtgccacacgacgagccggtcttcctgcagtggccgcagagcccctgcctgtcggccgtcgacctcggcgccgccattcttggcggccagtacatgcacctgccggtgcccgctccgcagccaccgtcgtcgccgggcgcggcgggcatgttctgggggctctgcaacgacgtgcaagcgccaaacaacaccggccacaagagctgcgcctggagcgccgggctcggccagcactggtgcggctccgccgatcagctcggcctcggcaagagcagcgcggcgtcgatcgccaccgtgtctaggccggaggaggcgcacgacgtcgacgccacgaagcacggtctgctacagtacggctttggcatcaccacgccgcaagtgcacgtggacgttacctcctcggctgctggcgttctgcctcctgttccgtcctcgccgtcgccgccgaacgccgccgtcaccgtcgcgagcgtggccgccaccgctagcctgactgattttgctgcaagtgctatatctgctggcgccgtcgctaacaatcagtttcaaggtactctttttgttctttga</cdnaseq> |
| Protein Sequence |
<aaseq>MSVTTAMDLLSPLAAACHQQMLYQGQPLESPPAPAPKVHGIVPH DEPVFLQWPQSPCLSAVDLGAAILGGQYMHLPVPAPQPPSSPGAAGMFWGLCNDVQAP NNTGHKSCAWSAGLGQHWCGSADQLGLGKSSAASIATVSRPEEAHDVDATKHGLLQYG FGITTPQVHVDVTSSAAGVLPPVPSSPSPPNAAVTVASVAATASLTDFAASAISAGAV ANNQFQGTLFVL</aaseq> |
| Gene Sequence |
<dnaseqindica>156..848#tcacgccgccgccaccaatcctcccggcgccccagccggtgcagccgcagcagcagcttgtctcgcctgtggcggcgcctacctcgtcgtcgtcttcctcctccgaccgttcgtccgggtccagcaagcctgcgagggctacgtcgacgcaggcgatgtccgtgacgacggccatggacctgctctcgccgctcgccgcggcgtgccaccagcagatgctctatcaaggccagccactggagtcgccgccggcgcctgctcccaaagtgcacggcatcgtgccacacgacgagccggtcttcctgcagtggccgcagagcccctgcctgtcggccgtcgacctcggcgccgccattcttggcggccagtacatgcacctgccggtgcccgctccgcagccaccgtcgtcgccgggcgcggcgggcatgttctgggggctctgcaacgacgtgcaagcgccaaacaacaccggccacaagagctgcgcctggagcgccgggctcggccagcactggtgcggctccgccgatcagctcggcctcggcaagagcagcgcggcgtcgatcgccaccgtgtctaggccggaggaggcgcacgacgtcgacgccacgaagcacggtctgctacagtacggctttggcatcaccacgccgcaagtgcacgtggacgttacctcctcggctgctggcgttctgcctcctgttccgtcctcgccgtcgccgccgaacgccgccgtcaccgtcgcgagcgtggccgccaccgctagcctgactgattttgctgcaagtgctatatctgctggcgccgtcgctaacaatcagtttcaaggtactctttttgttctttgatatgaagaatttaattaactggtcaaatcatgaatcaccaccatttagctagattatctgttggcattttttcccctttgttcagtatcacatgcatgcatcatattcatacgctcatgtttaaatggattaattagaagtgtcacttcaggggagtctaacttctcttgtagtgttgtcctcaatttcagtttcgtttggatttaactacaaaatgacaaattttttactgaaagaagaattgtatatgcatgaaattgtactgtactagtttcctttagggcccaatccaaaccagccgttctcaaacaagggccctgtgcccaggcatggcaatgataataagacaagtttaggccatgtaaaatccttttcttttgtgtgtctgtacaatcttatcacttcaatgcagatagactttccagtaaagatgaagaaatttgtcattttgtaagcatgtagatttagacaagaccaaaatttgtgagctgttctccatcaggtcaaattgagtaggtttcttgatgggatgttacaaatatgcgaactactagtactactgctatttcatggtgatggggaacatcatgtcatcgcatgtagatgcattcagctcccacatgctccctccatccaaaaaaaagacaaaccctggtttgcatgtgcaacgtttgaccgtccgtcgtattt</dnaseqindica> |
| External Link(s) |
