Difference between revisions of "Os07g0129200"
(→References) |
|||
| Line 17: | Line 17: | ||
==References== | ==References== | ||
| − | + | Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316 | |
| + | |||
| + | |||
| + | Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9 | ||
| + | |||
| + | |||
| + | Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165 | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 08:16, 26 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9
Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
Structured Information
| Gene Name |
Os07g0129200 |
|---|---|
| Description |
PR1a protein |
| Version |
NM_001065350.1 GI:115470432 GeneID:4342317 |
| Length |
792 bp |
| Definition |
Oryza sativa Japonica Group Os07g0129200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:1544202..1544993 |
| Sequence Coding Region |
1544290..1544796 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:1544202..1544993 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:1544202..1544993 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MASSSSRLSCCLLVLAAAAMAATAQNSAQDFVDPHNAARADVGV GPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIFWGSAGGDWTAASAVSAWV SEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPG NFVGQSPY</aaseq> |
| Gene Sequence |
<dnaseqindica>89..595#tcgatctccatcatctcttcgtctactaacaaagttataatatcaaattaaggtatatatatatatatatagtagctagcttcaattaatggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactgattaattaattaattatattatcacactcactaattaatcatatcgtatgctatgctacgtgtttatgcatgtatggacatgtagtgtcatatggtatatcgtatatgtgtacgtataatatacgtacgtatgctggtgagaataaatccgatgaataaataaataaagctgtactgtcagccgtatttgcttagtgt</dnaseqindica> |
| External Link(s) |
