Os08g0114200

The rice Os08g0114200 is OsGLU3 which is similar to CEL5=CELLULASE 5 coding a β-1,4-endoglucanase，playing an significant role in root elongation in rice

Annotated Information

Function

The gene OsGLU3 (Os08g0114200), a β-1,4-endoglucanase, can affect the cellulose synthesis for root elongation in rice. And the phosphate starvation induced root elongation in rice depends on the function of OsGLU3 (Os08g0114200). Which was researched that OsGLU3 (Os08g0114200) is also dispensable for nitrogen starvation induced root elongation in rice. The test:The Wild type (WT, SSBM) were grown for 10 d in media without nitrogen and transferred to low nitrogen media (2 mg/L nitrogen) or control media (40 mg/L nitrogen) for another 20d respectively. The nitrogen starvation stress leads to an around 20% increase of primary root elongation in WT as compared with that gro wn under the control condition, Fig1A). It showed that nitrogen starvation can lead to an increase of approximately 13% in rice root cell elongation (Fig1C and E).It also found that the nitrogen starvation can lead to an approximately 15% increase in root cellulose content (Fig1D). It was iden tified phosphate starvation and the nitrogen starvation stimulate primary root elongation by inducing root cell elongation and activating root mitotic activity. It suggests that nitrogen starvation induced primary root elongation depends on the activity of OsGLU3 (Os08g0114200). An OsGLU3(Os08g0114200) dependant way affec t root cell wall cellulose synthesis by modulating root architectureboth in the phosphate or nitrogen starvation in rice.OsGLU3 (Os08g0114200)is a key player in the carbon partitioning system, as loss of function of it can abolish the response (1). The fully functional OsGLU3–GFP was detected in plasma membrane, and FM4-64-labeled compartments in the root meristem and elongation zones .In conclusion, it demonstrated that OsGLU3 was involved in the synthesis of root cellulose and thereby modulate root cell division and elongation in rice. Phosphate starvation, an environmental stress, induces root cellulose synthesis for root elongation, and OsGLU3 is a key player in this process(3).

Mutation

Screeningan ethylmethane sulfonate (EMS) mutagenized rice library, and isolated a short root mutant,Osglu3-1. The map-based cloning results showed that the mutant was due to a point mutation in OsGLU3, which encodes a putative membrane-bound endo-1,4-b-glucanase. Osglu3-1 displayed less crystalline cellulose content in its root cell wall, shorter root cell length, and a slightly smaller root meristem as visualized by restricted expression of OsCYCB1,1:GUS. Exogenous application of glucose can suppress both the lower root cell wall cellulose content and short root phenotypes ofOsglu3-1.The mutant resulted from a mutation in a rice KOR1 homolog OsGLU3, which encodes a putative membranebound endo-1,4-b-glucanase. OsGLU3 can affect root cell wall cellulose synthesis to modulate root elongation. Phosphate starvation, an environmental stress,can modulate root cell wall cellulose synthesis to induce root growth in an OsGLU3-dependent way. the cell length of mature epidermal cells was only one-third of those in the WT, while the root hair length of the mutant is similar to that of WT (Fig 3B and 3C ).The region expressing the OsCYCB1,1:GUSin the root meristem of mutant is about 90% of that in WT (Fig 3D and 3E). Together,these data suggest that the short root phenotype of Osglu3-1results from defects in both root cell elongation and division,particularly defect in cell elongation.the mutation of OsGLU3 might lead to an alteration of cell wall components in root tissue.The results showed that Osglu3-1 had almost the same concentration of cell wall cellulose as WT grown on medium with 3% exogenous glucose. Moreover, the cellulose content of WT and Osglu3-1 had statistically increased after the application of 3% glucose (Fig 3F).The root growth response ofOsglu3-2to glucose treatment was also tested. As with the Osglu3-1 mutant, the application of 3% glucose suppressed the short root and short lateral root defect of Osglu3-2(Fig 3G).Together, these data indicate that OsGLU3 modulates root cell wall cellulose synthesis and affects root cell elongation and division. The exogenous application of glucose can restore the root cell wall cellulose synthesis and rescue the root growth defects of Osglu3 mutants (3).

Expression

In the rice genome, endo-1,4-b-D-glucanases form a multiple gene family including OsGLU3 which share high sequence similarity with KOR1 (2). OsGLU3is ubiquitously expressed in various tissues with strong expression in root tip, lateral root, and crown root primodia. OsGLU3contains four exons and three introns (Fig 2B). The putative OsGLU3 was predicted to contain a transmembrane domain, a cytosolic domain, and a catalytic domain (Supplemental Fig 3A). The mutation is located in the catalytic domain, which is highly conserved among the plant KOR1 homologs (Supplemental Fig 3B). qRT–PCR showed that the OsGLU3 is highly expressed in root tissue and has relatively lower expression in the other tissues. The OsGLU3–GUS expression was observed ubiquitously in the rice plants included in leaf veins, excoemums,and roots. the OsGLU3–GFP protein may reflect the native OsGLU3.OsGLU3 localizes in the plasma member and endosomes, and the export of OsGLU3 to the PM depends on vesicle transport. Phosphate starvation could induce root elongation inOsglu3-1.The phosphate starvation-induced primary root elongation and cellulose-content increase are abolished inOsglu3-2, which suggests that phosphate starvation-induced primary root elongation depends on the activity of OsGLU3 (3).

Evolution

Please input evolution information here.

In rice genome, the putative membrane-anchored endo-b-1,4-D-glucanases were encoded by three genes: OsGLU1, OsGLU2, and OsGLU3.

Labs working on this gene

1.National Key Lab of Plant Genomics,People’s Republic of China. 2.Institute of Genetics and Developmental Biology, Chinese Academy of Sciences ,People’s Republic of China. 3.The State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University,People’s Republic of China. 4.College of Science and Technology, Ningbo University, Ningbo, Zhejiang , China. 5.State Key Laboratory Breeding Base for Zhejiang Sustainable Pest and Disease Control, People’s Republic of China. 6.Institute of Virology and Biotechnology, Zhejiang Academy of Agricultural Sciences, Hangzhou , People’s Republic of China.

References

1. Zhang J, Xu L, Wang F, Deng M, Yi K. Modulating the root elongation by phosphate/nitrogen starvation in an OsGLU3 dependant way in rice. Plant signaling & behavior. 2012;7(9):1144-5. 2. Zhou HL, He SJ, Cao YR, Chen T, Du BX, Chu CC, et al. OsGLU1, a putative membrane-bound endo-1,4-beta-D-glucanase from rice, affects plant internode elongation. Plant molecular biology. 2006;60(1):137-51. 3. Zhang JW, Xu L, Wu YR, Chen XA, Liu Y, Zhu SH, et al. OsGLU3, a putative membrane-bound endo-1,4-beta-glucanase, is required for root cell elongation and division in rice (Oryza sativa L.). Mol Plant. 2012;5(1):176-86.

Structured Information

Gene Name	Os08g0114200
Description	Similar to CEL5=CELLULASE 5 (Fragment)
Version	NM_001067383.1 GI:115474502 GeneID:4344508
Length	1867 bp
Definition	Oryza sativa Japonica Group Os08g0114200, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 8
Location	Chromosome 8:762215..764081
Sequence Coding Region	762288..762572,762658..763944
Expression	GEO Profiles:Os08g0114200
Genome Context	<gbrowseImage1> name=NC_008401:762215..764081 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008401:762215..764081 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atgtgcagttggtcactctcgagccacactctcacttcgccggtgaggcaggcagcaatggagccaaagagcagcagctgcggcggcgccggcattcggctgcggctgctggtcgtgctccacctgctgctcttagttccgagctcggccatggcgttcaactacgccgacgcgctcgccaagtccatcatcttcttcgagggccagcgctccggcaagctcccgcccggcaaccgcatgccgtggcgcgccgactccggcctcaccgacggcgcccagtacaatgtggatttggtgggcgggtactacgacgccggcgacaacgtcaagttcggcctgcccatggcgttctcgacgacgatgctggcgtggagcgtgctcgacttcggcaagttcatgggcgccgagctgcccaacgcccgcgccgccgtgcgctggggcgccgactacctcctcaaggccgccaccgccacgcccggcgcgctctacgtccaggtcgccgaccccaaccaggaccaccgctgctgggagcgccccgaggacatggacacaccccgcagcgtctaccgcgtcaccgccgacaagccgggttccgacgtcgccggcgagacggccgccgcgctcgccgcgtcgtccatggtgttccgccgcgccgacccggcctactccgcgcgcctcctccacgccgcgacgcaggtgttcgacttcgccgaccggcaccgcgggtcgtacagcgactcgctggcgtcgtcggtgtgcccgttctactgctcctactcgggctaccacgacgagctcctgtggggggcgtcgtggctgcaccgcgcgtcgaggaacgcgtcgttcatgtcgtacgtggaggcgaacgggatgcagctcggcgccggggacgacgactactccttcagctgggacgacaagcgggtgggcaccaaggtgctcctcgccaagggcttcctccgcaaccgcctccatggcctcgagctctacaaggcgcactccgacagctacatctgctcgctggtgcccggcacggcgagcttccagtcgcggtacacccccggcggcctcctgtacagggaaggctccagcaacatgcagtacgtgacgacggcgacgttcctgatgctggcgtacgccaagtacctccggtcgagcggcgccaccgcgtcgtgcggcgacggcggcggcggagcgaggggggaggtgtcggcggcggagctggtggcggtggcgaagcggcaggtggactacatcctggggaagaacccggcggggatgtcgtacatggtggggttcgggtgcaggtacccgaggcgggcgcaccaccgcggcgcgtccatgccgtcggtgcgcgcccacccggggcggatctcctgcgacgccggcttcggctacctccactccggcgagcccaacccgaacgtgctcgtcggcgccgtcgtcggcgggccggacagccgcgacgcctttgccgacgaccgcggcaacttcgcgcagtcggagccggccacctacatcaacgcgccgctcgtcggcgcgctcgcctacttcgccggaaccaccaagtag</cdnaseq>
Protein Sequence	<aaseq>MCSWSLSSHTLTSPVRQAAMEPKSSSCGGAGIRLRLLVVLHLLL LVPSSAMAFNYADALAKSIIFFEGQRSGKLPPGNRMPWRADSGLTDGAQYNVDLVGGY YDAGDNVKFGLPMAFSTTMLAWSVLDFGKFMGAELPNARAAVRWGADYLLKAATATPG ALYVQVADPNQDHRCWERPEDMDTPRSVYRVTADKPGSDVAGETAAALAASSMVFRRA DPAYSARLLHAATQVFDFADRHRGSYSDSLASSVCPFYCSYSGYHDELLWGASWLHRA SRNASFMSYVEANGMQLGAGDDDYSFSWDDKRVGTKVLLAKGFLRNRLHGLELYKAHS DSYICSLVPGTASFQSRYTPGGLLYREGSSNMQYVTTATFLMLAYAKYLRSSGATASC GDGGGGARGEVSAAELVAVAKRQVDYILGKNPAGMSYMVGFGCRYPRRAHHRGASMPS VRAHPGRISCDAGFGYLHSGEPNPNVLVGAVVGGPDSRDAFADDRGNFAQSEPATYIN APLVGALAYFAGTTK</aaseq>
Gene Sequence	<dnaseqindica>74..358#444..1730#agcaaattgatatactactccagcaccggccaaattaactaacttaacggccactgcttttcacactatattaatgtgcagttggtcactctcgagccacactctcacttcgccggtgaggcaggcagcaatggagccaaagagcagcagctgcggcggcgccggcattcggctgcggctgctggtcgtgctccacctgctgctcttagttccgagctcggccatggcgttcaactacgccgacgcgctcgccaagtccatcatcttcttcgagggccagcgctccggcaagctcccgcccggcaaccgcatgccgtggcgcgccgactccggcctcaccgacggcgcccagtacaatgtacgtacgccgcctctctctctttccctttcttccttgtctccggcgaggaggagtttgtgattccggcgtgtttgtgtttcaggtggatttggtgggcgggtactacgacgccggcgacaacgtcaagttcggcctgcccatggcgttctcgacgacgatgctggcgtggagcgtgctcgacttcggcaagttcatgggcgccgagctgcccaacgcccgcgccgccgtgcgctggggcgccgactacctcctcaaggccgccaccgccacgcccggcgcgctctacgtccaggtcgccgaccccaaccaggaccaccgctgctgggagcgccccgaggacatggacacaccccgcagcgtctaccgcgtcaccgccgacaagccgggttccgacgtcgccggcgagacggccgccgcgctcgccgcgtcgtccatggtgttccgccgcgccgacccggcctactccgcgcgcctcctccacgccgcgacgcaggtgttcgacttcgccgaccggcaccgcgggtcgtacagcgactcgctggcgtcgtcggtgtgcccgttctactgctcctactcgggctaccacgacgagctcctgtggggggcgtcgtggctgcaccgcgcgtcgaggaacgcgtcgttcatgtcgtacgtggaggcgaacgggatgcagctcggcgccggggacgacgactactccttcagctgggacgacaagcgggtgggcaccaaggtgctcctcgccaagggcttcctccgcaaccgcctccatggcctcgagctctacaaggcgcactccgacagctacatctgctcgctggtgcccggcacggcgagcttccagtcgcggtacacccccggcggcctcctgtacagggaaggctccagcaacatgcagtacgtgacgacggcgacgttcctgatgctggcgtacgccaagtacctccggtcgagcggcgccaccgcgtcgtgcggcgacggcggcggcggagcgaggggggaggtgtcggcggcggagctggtggcggtggcgaagcggcaggtggactacatcctggggaagaacccggcggggatgtcgtacatggtggggttcgggtgcaggtacccgaggcgggcgcaccaccgcggcgcgtccatgccgtcggtgcgcgcccacccggggcggatctcctgcgacgccggcttcggctacctccactccggcgagcccaacccgaacgtgctcgtcggcgccgtcgtcggcgggccggacagccgcgacgcctttgccgacgaccgcggcaacttcgcgcagtcggagccggccacctacatcaacgcgccgctcgtcggcgcgctcgcctacttcgccggaaccaccaagtagccattagtgagagtgtgagtgacgtggcagtgtgggagcgcgaggccagtgagatgagctcccccgccacgctgtatcgttcgttgactttgtcgtgtattcgacgcaacaaacagtatttgcacggagtacgtacg</dnaseqindica>
External Link(s)	NCBI Gene:Os08g0114200, RefSeq:Os08g0114200