Difference between revisions of "Os07g0129200"

From RiceWiki
Jump to: navigation, search
(References)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Pathogenesis-related proteins have production/accumulation represents an essential component of the active plant defence repertoire.They are defined as plant proteins that are induced specifically in pathological or related situations.Activation of OsPR1 genes is an important part of the defence/stress response(s) in rice.
 +
 
 +
 
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1)
 +
(fig2).
 +
[[File:Expression of OsPR1 influenced.JPG]]
 +
fig1:The expression of OsPR1a and OsPR1b genes influenced by SA, ABA and H2O2
 +
 
 +
[[File:Expression of OsPR1 influenced by SA.JPG]]
 +
fig2:The progress of OsPR1a and OsPR1b genes expression influenced by SA, ABA and H2O2
 +
 
 +
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment.
 
+
[[File:Homologous sequences.JPG]]
You can also add sub-section(s) at will.
+
fig3:Rice PR1 protein sequence (OsPR1a) with homologous sequences
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 09:18, 26 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Pathogenesis-related proteins have production/accumulation represents an essential component of the active plant defence repertoire.They are defined as plant proteins that are induced specifically in pathological or related situations.Activation of OsPR1 genes is an important part of the defence/stress response(s) in rice.


Expression

OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1) (fig2). Expression of OsPR1 influenced.JPG fig1:The expression of OsPR1a and OsPR1b genes influenced by SA, ABA and H2O2

Expression of OsPR1 influenced by SA.JPG fig2:The progress of OsPR1a and OsPR1b genes expression influenced by SA, ABA and H2O2


Evolution

Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment. Homologous sequences.JPG fig3:Rice PR1 protein sequence (OsPR1a) with homologous sequences

Labs working on this gene

Please input related labs here.

References

Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316


Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9


Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165

Structured Information

Gene Name

Os07g0129200

Description

PR1a protein

Version

NM_001065350.1 GI:115470432 GeneID:4342317

Length

792 bp

Definition

Oryza sativa Japonica Group Os07g0129200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:1544202..1544993

Sequence Coding Region

1544290..1544796

Expression

GEO Profiles:Os07g0129200

Genome Context

<gbrowseImage1> name=NC_008400:1544202..1544993 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:1544202..1544993 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactga</cdnaseq>

Protein Sequence

<aaseq>MASSSSRLSCCLLVLAAAAMAATAQNSAQDFVDPHNAARADVGV GPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIFWGSAGGDWTAASAVSAWV SEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPG NFVGQSPY</aaseq>

Gene Sequence

<dnaseqindica>89..595#tcgatctccatcatctcttcgtctactaacaaagttataatatcaaattaaggtatatatatatatatatagtagctagcttcaattaatggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactgattaattaattaattatattatcacactcactaattaatcatatcgtatgctatgctacgtgtttatgcatgtatggacatgtagtgtcatatggtatatcgtatatgtgtacgtataatatacgtacgtatgctggtgagaataaatccgatgaataaataaataaagctgtactgtcagccgtatttgcttagtgt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0129200, RefSeq:Os07g0129200