Difference between revisions of "Os04g0475600"

From RiceWiki
Jump to: navigation, search
(Undo revision 173106 by Yuki (talk))
Line 38: Line 38:
  
 
[3]Zhigang Zhao, Yunhui Zhang, Xi Liu.ect(2013). A Role for a Dioxygenase in Auxin Metabolism and Reproductive Development in Rice. Developmental Cell. 14 October 2013, 113–122.
 
[3]Zhigang Zhao, Yunhui Zhang, Xi Liu.ect(2013). A Role for a Dioxygenase in Auxin Metabolism and Reproductive Development in Rice. Developmental Cell. 14 October 2013, 113–122.
−
 
−
[4]Bartel B, Fink GR. Differential regulation of an auxin-producing nitrilase gene family in Arabidopsis thaliana. Proc Natl Acad Sci U S A. 1994 Jul 5;91(14):6649–6653.
 
−
 
−
[5]Bartling D, Seedorf M, Schmidt RC, Weiler EW. Molecular characterization of two cloned nitrilases from Arabidopsis thaliana: key enzymes in biosynthesis of the plant hormone indole-3-acetic acid. Proc Natl Acad Sci U S A. 1994 Jun 21;91(13):6021–6025.
 
−
 
−
[6]Bialek K, Cohen JD. Isolation and Partial Characterization of the Major Amide-Linked Conjugate of Indole-3-Acetic Acid from Phaseolus vulgaris L. Plant Physiol. 1986 Jan;80(1):99–104.
 
−
 
−
[7]Bilang J, Macdonald H, King PJ, Sturm A. A soluble auxin-binding protein from Hyoscyamus muticus is a glutathione S-transferase. Plant Physiol. 1993 May;102(1):29–34.
 
−
 
−
[8]Costacurta A, Keijers V, Vanderleyden J. Molecular cloning and sequence analysis of an Azospirillum brasilense indole-3-pyruvate decarboxylase gene. Mol Gen Genet. 1994 May 25;243(4):463–472.
 
−
 
−
[9]Hangarter RP, Good NE. Evidence That IAA Conjugates Are Slow-Release Sources of Free IAA in Plant Tissues. Plant Physiol. 1981 Dec;68(6):1424–1427.
 
−
 
−
[10]Jensen PJ, Bandurski RS. Metabolism and Synthesis of Indole-3-Acetic Acid (IAA) in Zea mays (Levels of IAA during Kernel Development and the Use of in Vitro Endosperm Systems for Studying IAA Biosynthesis). Plant Physiol. 1994 Sep;106(1):343–351.
 
−
 
−
[11]Koga J, Adachi T, Hidaka H. Molecular cloning of the gene for indolepyruvate decarboxylase from Enterobacter cloacae. Mol Gen Genet. 1991 Apr;226(1-2):10–16.
 
−
 
−
[12]Michalczuk L, Ribnicky DM, Cooke TJ, Cohen JD. Regulation of indole-3-acetic Acid biosynthetic pathways in carrot cell cultures. Plant Physiol. 1992 Nov;100(3):1346–1353.
 
−
 
−
[13]Normanly J, Cohen JD, Fink GR. Arabidopsis thaliana auxotrophs reveal a tryptophan-independent biosynthetic pathway for indole-3-acetic acid. Proc Natl Acad Sci U S A. 1993 Nov 1;90(21):10355–10359.
 
−
 
−
[14]Szerszen JB, Szczyglowski K, Bandurski RS. iaglu, a gene from Zea mays involved in conjugation of growth hormone indole-3-acetic acid. Science. 1994 Sep 16;265(5179):1699–1701.
 
−
 
−
[15]Tam YY, Slovin JP, Cohen JD. Selection and Characterization of [alpha]-Methyltryptophan-Resistant Lines of Lemna gibba Showing a Rapid Rate of Indole-3-Acetic Acid Turnover. Plant Physiol. 1995 Jan;107(1):77–85.
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 02:50, 27 May 2014

This gene named dioxygenase for auxin oxidation gene or 2-oxoglutarate-dependent-Fe (II) dioxygenase.Its gene symbol is DAO.This gene code 2-oxoglutarate-dependent-Fe (II) dioxygenase which is essential for anther dehiscence, pollen fertility, and seed initiation in rice.In vitro recombination,the gene DAO make active IAA into no biological activity of 2 - indole 3 acetic oxide. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries.

Expression

The identification of the rice dioxygenase for auxin oxidation (DAO) gene, which encodes a 2-oxoglutarate-dependent-Fe (II) (2OGFe (II))dioxygenase responsible for catalyzing the irreversible oxidation of IAA to OxIAA and essential for plant reproductive development.Sequence and phylogenetic analysis showed that DAO is a single copy gene in rice that is predicted to encode a 2OG-Fe(II) dioxygenase with a dioxygenase domain that is conserved in several classes of dioxygenase, including the GA-2 oxidase(GA2ox), GA-3 oxidase (GA3ox), and GA-20 oxidase (GA20ox).

Highlight

•Rice dao mutants contain increased levels of free IAA in anthers and ovaries

•dao mutants are defective in anther dehiscence, pollen grains, and seed development

•DAO encodes a 2-oxoglutarate-dependent-Fe (II) dioxygenase

•DAO catalyzes the conversion of active IAA into biologically inactive OxIAA

Evolution

Indole-3-acetic acid (IAA), the natural auxin in plants, regulates many aspects of plant growth and development. Extensive analyses have elucidated the components of auxin biosynthesis, transport, and signaling, but the physiological roles and molecular mechanisms of auxin degradation remain elusive. Here, we demonstrate that the dioxygenase for auxin oxidation (DAO) gene, encoding a putative 2-oxoglutarate-dependent-Fe (II) dioxygenase, is essential for anther dehiscence, pollen fertility, and seed initiation in rice. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries. Furthermore, exogenous application of IAA or overexpression of the auxin biosynthesis gene OsYUCCA1 phenocopies the dao mutants. We show that recombinant DAO converts the active IAA into biologically inactive 2-oxoindole-3-acetic acid (OxIAA) in vitro. Collectively, these data support a key role of DAO in auxin catabolism and maintenance of auxin homeostasis central to plant reproductive development.


This gene is belong to oryza sativa and it is one of the world's oldest crop specise.In a heavy huge scale study,US researchers have thought oryza sativa orginated in China.As soon as 800 years ago appear in the Yangtze basin China.This gene is on the fourth chromsome in the rice.

Labs working on this gene

Shenyang Institute of Aeronautical Engineering, Feng-t’ien, Liaoning, China

Climate Stress Laboratory Janet P. Slovin

Horticultural Crops Quality Laboratory Jerry D. Cohen

United States Department of Agriculture, Beltsville, Maryland

References

[1]Spielmeyer, W., Ellis, M.H., and Chandler, P.M. (2002). Semidwarf (sd-1),‘‘green revolution’’ rice, contains a defective gibberellin 20-oxidase gene.Proc. Natl. Acad. Sci. USA 99, 9043–9048.

[2]Normanly, J., Slovin, J.P., and Cohen, J.D. (1995). Rethinking auxin biosynthesis and metabolism. Plant Physiol. 107, 323–329.

[3]Zhigang Zhao, Yunhui Zhang, Xi Liu.ect(2013). A Role for a Dioxygenase in Auxin Metabolism and Reproductive Development in Rice. Developmental Cell. 14 October 2013, 113–122.

Structured Information

Gene Name

Os04g0475600

Description

2OG-Fe(II) oxygenase domain containing protein

Version

NM_001059610.1 GI:115458949 GeneID:4336150

Length

1939 bp

Definition

Oryza sativa Japonica Group Os04g0475600, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:24194135..24196073

Sequence Coding Region

24194432..24194674,24194894..24195212,24195312..24195652

Expression

GEO Profiles:Os04g0475600

Genome Context

<gbrowseImage1> name=NC_008397:24194135..24196073 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:24194135..24196073 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtggagatcccggcgatcgacctgcggctggccggcggcggcggcggcgcggaggagacggcgaggctgcgcgacgcgtgcgcgcggctgggctgcttccgggtgtcggggcacggcgtgccgccggggctccaggccgagatgaaggccgcggtgcgcgcgctcttcgacctccccgacgacgccaagcgccgcaacgccgacatcatcccgggcagcggctacgtcccgcccggcacagccaacccgctctacgaggccttcggcctctgcgacgccgccgcccccgccgacgtcgacgccttctgcgcccgcctcgacgcgccgccccacgtcagggagaccgtgaaggcgtacgccgagaggatgcactcgctgatcgtggacgtcgccggcaaggtcgccgcgagcctggggctgcacggcgcctcgttccaggactggccgtgccagttccgcatgaacaggtacaactacacgcaggactccgtgggctcccccggcgtgcaggtccacacggactccggcttcctcaccgtgctccaggaggacgagtgcgttggcgggctcgaggtgctcgaccccgccgccggcgagttcgtccccgtcgaccccctccccggctcgttcgtcgtcaacgtcggcgacgtcggccaggcgtggagcaacgggaggctgcacaacgtgaagcacagggtgcagtgcgtggcggcggtgccgcgcgtgtcgatcgccatgttcctgctggcgcccaaggacgacacggtgagcgcgccgggggagctggtggacggcgagcacccgcgccggtacagggagttcaagtacgacgactaccggaggctccggctgtccaccggcgagcgcgccggcgaggcgctcgcgcgtctggcggcctga</cdnaseq>

Protein Sequence

<aaseq>MVEIPAIDLRLAGGGGGAEETARLRDACARLGCFRVSGHGVPPG LQAEMKAAVRALFDLPDDAKRRNADIIPGSGYVPPGTANPLYEAFGLCDAAAPADVDA FCARLDAPPHVRETVKAYAERMHSLIVDVAGKVAASLGLHGASFQDWPCQFRMNRYNY TQDSVGSPGVQVHTDSGFLTVLQEDECVGGLEVLDPAAGEFVPVDPLPGSFVVNVGDV GQAWSNGRLHNVKHRVQCVAAVPRVSIAMFLLAPKDDTVSAPGELVDGEHPRRYREFK YDDYRRLRLSTGERAGEALARLAA</aaseq>

Gene Sequence

<dnaseqindica>1400..1642#862..1180#422..762#agaagcaaacactgcgatcatccgaagcaatctcaatctcacctgtccatatcgcgcacgaattcgtaaagtgcaagctagaaacatgtgtcacatgtcgtgctgatcgttcgatccaccacggtgcgagcggtgagtgtcgtgacgaagcaaaggcagaggcagcagcgggaaacggcgcccccccgtgtgtcgatcggctgtctcgccgaacagggcaaatacgccaacaaaaaacggcctcgttttcccttgctcgcacgcaccgtgtcgctcccaggcgacaagccgtggcgcgactcgccgcccccctgcgccccctcgcccccgcgcgtcgctttcacgtcgcacctctaaataccaccaccccggactcggcggcgagcccccgcgccaagaacgaaaggcgagagtgagagagatggtggagatcccggcgatcgacctgcggctggccggcggcggcggcggcgcggaggagacggcgaggctgcgcgacgcgtgcgcgcggctgggctgcttccgggtgtcggggcacggcgtgccgccggggctccaggccgagatgaaggccgcggtgcgcgcgctcttcgacctccccgacgacgccaagcgccgcaacgccgacatcatcccgggcagcggctacgtcccgcccggcacagccaacccgctctacgaggccttcggcctctgcgacgccgccgcccccgccgacgtcgacgccttctgcgcccgcctcgacgcgccgccccacgtcaggtgaccatttactgatcttgcaccgccccccaatcccaattggaattgcgattttggtctcaagaaacggatgaattaatccgggcccggatgaagcagggagaccgtgaaggcgtacgccgagaggatgcactcgctgatcgtggacgtcgccggcaaggtcgccgcgagcctggggctgcacggcgcctcgttccaggactggccgtgccagttccgcatgaacaggtacaactacacgcaggactccgtgggctcccccggcgtgcaggtccacacggactccggcttcctcaccgtgctccaggaggacgagtgcgttggcgggctcgaggtgctcgaccccgccgccggcgagttcgtccccgtcgaccccctccccggctcgttcgtcgtcaacgtcggcgacgtcggccaggttcacaaacatatcatcaaaatatattcaatttaattactaaaattaataagatatatccctccgtcggtgctgtaggtgttgttatttttctataaatttgattcaacctaaaaatattaagaaaatatcaaacgacttataattcgagacgaagggagtaactactattccatttttcgcgggaatttctcaccgaatctcggtgtgttgtctcaggcgtggagcaacgggaggctgcacaacgtgaagcacagggtgcagtgcgtggcggcggtgccgcgcgtgtcgatcgccatgttcctgctggcgcccaaggacgacacggtgagcgcgccgggggagctggtggacggcgagcacccgcgccggtacagggagttcaagtacgacgactaccggaggctccggctgtccaccggcgagcgcgccggcgaggcgctcgcgcgtctggcggcctgacacctggccacggtccattgtcgcgaccgtttattacgcggagtgctcactgctgactagaatgtccattaggcctccctgtatggccgtgtcgattctgaacaataaaatcttcgacgtacgacagtgaaaaaaatttgtaaaggatgctgaggggatgggaattttaggggttaataagtcttttgtttggctggaggagatgatgagttgtaggaataactggaaggtggagtttgtgagtaaattcccacctttttaatatagaggactataattgggaggaaagtccctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0475600, RefSeq:Os04g0475600

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0475600&oldid=173108"