Difference between revisions of "Os05g0107700"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 9: Line 9:
 
Although X. oryzae pv. oryzae multiplied extensively in resistant IR lines, lesion lengths were consistently less than 4 cm. Genetic background may play a role in resistance mediated by specific Xa genes. X. oryzae pv. oryzae -xa5 dynamics appear to differ in the indica and japonica NILs. Bacterial movement is restricted in both indica and japonica resistant plants. In both indica and japonica NILs, X. oryzae pv. oryzae movement down the leaf was dramatically faster in susceptible than in resistant leaves. Movement in resistant leaves appeared to be more restricted in JR than IR.
 
Although X. oryzae pv. oryzae multiplied extensively in resistant IR lines, lesion lengths were consistently less than 4 cm. Genetic background may play a role in resistance mediated by specific Xa genes. X. oryzae pv. oryzae -xa5 dynamics appear to differ in the indica and japonica NILs. Bacterial movement is restricted in both indica and japonica resistant plants. In both indica and japonica NILs, X. oryzae pv. oryzae movement down the leaf was dramatically faster in susceptible than in resistant leaves. Movement in resistant leaves appeared to be more restricted in JR than IR.
  
No significant difference between untransformed susceptible japonicas (JS) and Xa5 transformed previously resistant japonicas (JR::Xa5) was observed. In the japonica subspecies as in the indica, xa5 operates as a recessive gene and genetic background does not affect its gene action. Since the transgenic JR::Xa5 plants contain two copies of the recessive resistant xa5 allele, one allele of Xa5 is sufficient for disease even in plants with two copies of xa5. Additional insertions of Xa5 do not result in increased disease severity in previously resistant genotypes,suggesting that Xa5 may be a susceptibility allele.
+
No significant difference between untransformed susceptible japonicas (JS) and Xa5 transformed previously resistant japonicas (JR::Xa5) was observed. In the japonica subspecies as in the indica, xa5 operates as a recessive gene and genetic background does not affect its gene action. Since the transgenic JR::Xa5 plants contain two copies of the recessive resistant xa5 allele, one allele of Xa5 is sufficient for disease even in plants with two copies of xa5. Additional insertions of Xa5 do not result in increased disease severity in previously resistant genotypes,suggesting that Xa5 may be a susceptibility allele(Iyer-Pascuzzi et al., 2008).
  
 
===Expression===
 
===Expression===

Revision as of 11:57, 27 May 2014

Os05g0107700 is a recessive gene associated with resistance to rice bacterial blight.

Function

Os05g0107700 represent gene “xa5”. The gene “xa5” provides racespecific resistance to “X. oryzae pv. oryzae”, and encodes the small subunit of transcription factor IIA(TFIIAγ). This recessive gene provides race-specific resistance to “X. oryzae pv. oryzae”, and is structurally unlike the more than 40 plant R genes previously cloned. xa5 is inherited in a completely recessive manner and the susceptible allele Xa5 is fully dominant. xa5-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.

Plants with lesions less than 4 cm are resistant, while those greater than 4 cm are susceptible. The susceptible indica isoline IR24 and the resistant indica isoline IRBB5 were referred to as IS and IR respectively. No significant difference in lesion length between IS and heterozygous F2s 14 dpi was observed. In addition, bacterial populations over time in heterozygous plants were similar to those in homozygous susceptible IS individuals. These results demonstrate that the Xa5 allele is not dose-dependent in the indica IR24 background.

Although X. oryzae pv. oryzae multiplied extensively in resistant IR lines, lesion lengths were consistently less than 4 cm. Genetic background may play a role in resistance mediated by specific Xa genes. X. oryzae pv. oryzae -xa5 dynamics appear to differ in the indica and japonica NILs. Bacterial movement is restricted in both indica and japonica resistant plants. In both indica and japonica NILs, X. oryzae pv. oryzae movement down the leaf was dramatically faster in susceptible than in resistant leaves. Movement in resistant leaves appeared to be more restricted in JR than IR.

No significant difference between untransformed susceptible japonicas (JS) and Xa5 transformed previously resistant japonicas (JR::Xa5) was observed. In the japonica subspecies as in the indica, xa5 operates as a recessive gene and genetic background does not affect its gene action. Since the transgenic JR::Xa5 plants contain two copies of the recessive resistant xa5 allele, one allele of Xa5 is sufficient for disease even in plants with two copies of xa5. Additional insertions of Xa5 do not result in increased disease severity in previously resistant genotypes,suggesting that Xa5 may be a susceptibility allele(Iyer-Pascuzzi et al., 2008).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA

Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA

CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America

Central Rice Research Institute (CRRI), Cuttack 753 006, India

International Rice Research Institute (IRRI), Los Banos, Philippines

College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China

Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA

References

A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch.Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295

Structured Information

Gene Name

Os05g0107700

Description

Transcription factor IIA small subunit (Transcription factor IIA gamma subunit)

Version

NM_001060961.1 GI:115461652 GeneID:4337575

Length

6227 bp

Definition

Oryza sativa Japonica Group Os05g0107700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:415085..421311

Sequence Coding Region

415426..415554,415649..415699,420795..420935

Expression

GEO Profiles:Os05g0107700

Genome Context

<gbrowseImage1> name=NC_008398:415085..421311 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:415085..421311 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataa</cdnaseq>

Protein Sequence

<aaseq>MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKS MTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSK LLSQ</aaseq>

Gene Sequence

<dnaseqindica>342..470#565..615#5711..5851#gtctcctccgctcctcctctccttgcgccaacaagccgactcgcgatctccatcgggcaagaagagcagagcagagcaggggaggggatcctgcaggtgaccatcctctttctttctttctttctttctctgaattcatctctctctctcccaccgggactctctacttttgtctggaatttgctcgcgttcgttcgttaaccctagcttctcttctcttctcttctagatctggaagaagctcttaatttcagagccttaacctctcttaatactacaagtaacaacagttttgttgtttgttccccccaccccaaaaagtttaggcgcacgcatcgcccatggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataaggtatctactttaccatatctccttccacctattactatctatactattgaaaaattcgactcctcattttgtttgttatcatctatgtgattagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaaggtatctgctcttatcacggagttgccatgttgctgttcctacccccccaaaaaaaaccaagccttacttgtgctgtgcataactttaatctctatctgtttcgagcctactcattatttatgcttgagaactcatatgcgcttgtgatgtaatttctccagtgctagaattgatacacttggttgtggattcagcgttgccattcgattttcttttccgtacacaccttgctaaaggaatcaagtctaaaatttgtttcttgcatatattatattattattattattcataaaggaatccattcacgttcgacacgtacctgtcctgtgtacgctgctctgagttctgagggatattgcacaaactttatagtaatgagtaagcgagtaacagaattaagacctatcagcaacataatacacgggcataaccagacaaatcttgcacttatcacatatatgcttttattttttcggctgtacaagcatatttccacttatcttattttgcaacacatcaagtactccttgagttgctcagattccaagctgctcatctgtgtttggccccaaaaaaaaagaaaagaaagaaaaaccttttattggataaacaagcctgagaaatgtcaagatcttttcttgccagcataatcctcaccaaaatgaaattatgaataaagattagtgtcattctttctgatacccatgtagtttgttattctatggcatgatagagattcttttttgtttgtgaattgggggtaatcacagaaatggactgatatttttgcccaacaatgggtgacttgtttacgtatcttactgtaatccgctttactcctggccccttgccccttttttataaatggaagtcaaaagtatgcaaaatataggcaactcgcacattacaatagcctcagaccctaactaccacatcgcaaccatgtgcgagttaggaatgccacacccggatgtgtgtcctctatgcgatcaggaggagactatacagcatattttggtgacttgtgttttttcctggcaagtatggtttttaatcttccaaatggttggatgggcgctgcagcactgcaaccatcaatgaatcgcttgtctagctggtggttcaaaacagttaaggatactcctaaagaggtaaagaaagggctgaactctttgattatcctagtggcatgggaaatatggaagcatcgcaatgattgtgtcttcaatggtgcctccccgagaatctcggctgttttgcatgcagtggctagagagagttctctttggtgtactgctggagcaaaggcactcctcgaaattctgtgtgggttgctccccctggacggctagtttctcctagggggtgtttcggttgcacgtcgcgttccgtgatgtttttttgtgtttctgtaggggtcctttgggtcactcggttgtacaatttctcttcttaatgaaatgaatcgcagtcctcctgtggtttcgagaaaaaaaaactcacacattgcaatattgcccatattaaaacactgatttttccccataaaccaaaacaagaaataaagtaactaagtgaccctggtgtgtacatgtttattagaacttctttatctgcaatattgtgcaagagaaacaagccgcaaacagcgttggagctcaataacaaaccagtaatgatgctagaaaccgtaccaaacataagacggtactctgctagaaaccttttttttttgtgccaagaagcgacttgaccactcaacatctcaatttcccttctgatcacaagcaatctagggctcatcgctgggttcgtacgataatcacacttccctgttctccattcttgtcatagttcagtgctctgctcctctaactgtgcttgtagtatcaatcagtcctctgggccattcgtagacgcaacaggcagctcaccaagttcgggtgaatcgttttgtcgtgtttattcttgtcccattagtcactagatagttcagcactgttcttgttattctattgatgcatttgtatatgactcattttcacgaaaggtgcatcaagagcattatattactgtagctatgtagttgttatcggtgagctttgctccatgctaaaagagttgggctaaatctatagcatttaagaattagttatagctggaaagatcatgtttgtcttgtagattcgactacctgatagcagctatccacctggatgatgaacagatctgtccatgacaacctgctgggctatggtgcatgcatgcacccatgtgataagtatgtaaaacgctatcctagatatagttttgcaagaattgatctctattgctaccggagactagaaaggtgttatggattggctagggcaagggtccgaagaccgggggatatagcactcgccctctaatagcagaggcagggcttctccctgctgagctaaaagaggctatgaggcttagggctaactttagagattcattgattgattgataagagtacatggggtcactttatatatagggaggacaggcttgacatccaaggaactaatctctagtactacagaaaccagtccaatctctatctctaactttctaataaacctcatctctttcctaattagataatctcctacctatatatgagtaattcgtaatttatgatgcctaaactgctgcatgggcctggtccatgcccataacactacacccctcgcggacagatagtcttcgagcactagcagatatcttcttggaaagaacttcaatggtagcagtcggcaaatcatcaaagcgaagtttgatatttttcttgagttctggccaagtttgaattccgtaggctcgctcaatcaactcataccacattgcggcaaacctggtccggtggcttgatgcaatccaccacttctcttcctccataaattcgctgctcaacaaagaactgctcaatactctccaaccaaatttgcggatcatcctcaccattgaacgttgggagaggttcaaggtggcgaaatctccacatccaattgaaatccccgctgcacgccatcgagggtggagcatcagttggctctgataccaaatgttatggattggctagggtaagggtgcaaagactgggggatagggcactcgccctctaatagcagaggcagggcttcttcctgctgagctaagaggctctgaggcctagggctagctttagagattcattgattgattgattgataatgcagtacgtgggacccctttatatatagggaggacaggcttgatatccaaggaactaatatctagtaccatagaaaccagtgcaatctctatctctaactttctaatagacctcatctctttcctaactagataatctcctacctttatatgagtaattcctaatttataatgcctaaactgctgcatgggcctggtccatgcccataacaaaaggaggtaaacgctatcttatagcttctaaatacggcacacctttatcatccatttctagttttggcttatggaaaaatcttcagttaaagcatttatgatattacaaaattgcagatgacgttttgtcggcatctgaactctcgtgaatctgctgcttgccccttcttagttgttccttaagttgtttcggcctttccaatttagcagtacacttaatcctcatgatccaaccatggccatcaattttcaattttcaactctgagcactctcgaccaatctcccatcagctgggacctattcagctgtctaagacatacattcacaaaggagattgcatgttctgattttcatttttacttgtaaaatgtaatgtttgcatagccattttgtatgtttagcctgaaaatggttgaagcatagttaccagttcatttgttttggtgttttacctgataatgtccagtgtatgaagacatgcgataattgataaattcatatatccggccactcttttacaactgtcactgtgtgggtttaagaaatccctcttttgacaaaccgcagttctctttttcttttccaaagaattgttaatcccacactgaattgctgtattaggaagggatcacctctacaatatgtcatttatgatatgtggtgttgagatgttacgtgttctgttttatttttgacgaaaatgcaggagaactggcattccattaaccattagctaagaaatgtacatggttttatcagtcataaactggacttactattttagaatcatgaactagagttttgctaatggaaattttaccattttaaaaatcatgaactggagtttgaattaatctctgttttatttatttttgagtaaatttcataaaactacatatactttgcatgatctatcacaaaactatagatttaagaacttatttcacaaaactacaaatttaatgtcttcgtttatcacaaaactacaggtattttacacaatatatcacaaaactacagatttaagaacttgtttcacaaaactacagatttaatatcttcatttatcataaaactacaggtttagtgtcttcattatcacaaaactacaggttttagcattgtcaaaacctgtagttttgtgataatggagacactaaatttgtagttttgtgataaatgaagacactaaatgtgtagtcctatgataaacgaatacactaattctatagttttgtgaaacaagttcttaaatctgtagttttgtgatagattgtacaaagtacctgtagttttgtgataaacgggcatactaaatctgtagttttgtgaaacaagctcttaaatctgtagttttgtgataaattgtgcaaaatacatgtagttttgtgaaatttactctttatttttctaacttgctatcctgctccagaaattttccattctagttacatgagtttaagcctcttgtcattttggacgcaatgtcgaacagacctgtatttgatggattttttttgtttatttaagaataagttctctggtacagcttagatacgatggatgattgactaactttttgagcctgtatttcagatattttgtagctgggctgtttactgatgcatgttcttttctcagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataaattgataactgcgaggtcagggtttgcctggtatttgttagtctcttctgctagacctggctccgcctgaagtgtactgtaccaccacattgtttgtttcataatcaatgtgtgtcaatacaatcgtatgtgctaccagagtatatcacagcagcaactgttttaatttgtatgcttatgtaattgttatgctactgctgtgttgataatgtgatataaatgactaaacgatgagtagtagaaattgtgcggagtcaccctcccccttcctcatttctgaaccctttggttctgtgtgactctttgtatgtaacatgaacaaatacctcctttcccgtcttttttttggatcctatgttaatggtacctttacatt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0107700, RefSeq:Os05g0107700