Difference between revisions of "Os01g0742500"

From RiceWiki
Jump to: navigation, search
(Mutation)
(Orientation)
Line 19: Line 19:
 
===Mutation===
 
===Mutation===
 
The expression of OsHXK5, OsHXK6, or their mutant alleles complemented the glucose insensitive2-1 mutant, thereby resulting in wild-type characteristics in seedling development, Glc-dependent gene expression, and plant growth.
 
The expression of OsHXK5, OsHXK6, or their mutant alleles complemented the glucose insensitive2-1 mutant, thereby resulting in wild-type characteristics in seedling development, Glc-dependent gene expression, and plant growth.
 
===Orientation===
 
Transient expression analyses using GFP fusion constructs revealed that OsHXK5 and OsHXK6 are associated with mitochondria.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 13:11, 27 May 2014

Please input one-sentence summary here.

Annotated Information

Introduction

Hexokinase(HXK) plays a significant role in Glucose metabolism and Glucose signal transduction. Rice has ten HXK genes including OsHXK1~10[1][2]. The hexokinase 1 (AtHXK1) is recognized as an important glucose (Glc) sensor. It was also proved that OsHXK5 and OsHXK6 are evolutionarily related to AtHXK1. To isolate rice hexokinases homologous to AtHXK1, Jung-Il Cho et al. first predicted the subcellular localization of OsHXKs using the TargetP program for determination of the presence of any N-terminal presequences, including putative mitochondrial targeting peptides (mTPs), and the predictNLS program for determination of NLSs. These analyses revealed that of the 10 OsHXKs, OsHXK5 and OsHXK6 had a predicted N-terminal mTP, 1MGKAAAVGTAVVVAAAVGVAVVLA24 for OsHXK5 and 1MGKGTVVGTAVVVCAAAAAAVGVAVVVS28 for OsHXK6. These analyses also indicated that both proteins contained a predicted NLS, 25RRRRRRDLELVEGAAAERKRK45 for OsHXK5 and 29RRRRSKRChoEAEEERRRR44 for OsHXK6, within their N-terminal domains. Together with our previous phylogenetic analyses of rice HXKs (Cho et al., 2006a), these data suggest that OsHXK5 and OsHXK6 are evolutionarily closely related to the Arabidopsis Glc sensor AtHXK1.

Function

These OsHXKs including OsHXK6 retain a dual-targeting ability to mitochondria and nuclei. Some results also provide evidence that rice OsHXK5 and OsHXK6 can function as Glc sensors. The OsHXK5DmTP-GFP and OsHXK6DmTP-GFP fusion proteins, which lack N-terminal mitochondrial targeting peptides, were present mainly in the nucleus with a small amount of the proteins seen in the cytosol. In addition, the OsHXK5NLS-GFP and OsHXK6NLS-GFP fusion proteins harboring nuclear localization signals were targeted predominantly in the nucleus, suggesting that these OsHXKs retain a dual-targeting ability to mitochondria and nuclei.

Expression

Transgenic rice plants overexpressing OsHXK5 or OsHXK6 exhibited hypersensitive plant growth retardation and enhanced repression of the photosynthetic gene RbcS in response to Glc treatment. In transient expression assays using promoter::luciferase fusion constructs, these two OsHXKs and their catalytically inactive alleles dramatically enhanced the Glc-dependent repression of the maize (Zea mays) Rubisco small subunit (RbcS) and rice a-amylase genes in mesophyll protoplasts of maize and rice.

Mutation

The expression of OsHXK5, OsHXK6, or their mutant alleles complemented the glucose insensitive2-1 mutant, thereby resulting in wild-type characteristics in seedling development, Glc-dependent gene expression, and plant growth.

Labs working on this gene

  1. Plant Metabolism Research Center and Graduate School of Biotechnology
  2. Department of Biology, Chungnam National University
  3. Department of Horticultural Biotechnology, Kyung Hee University
  4. Department of Life Sciences, Pohang University of Science and Technology
  5. Department of Molecular Biology, Massachusetts General Hospital, Department of Genetics, Harvard Medical School, Boston, Massachusetts
  6. Plant Metabolism Research Center
  7. Graduate School of Biotechnology, Kyung Hee University
  8. Division of Molecular and Life Sciences, Pohang University of Science and Technology

References

1. Jung-Il Cho2, Nayeon Ryoo2, Joon-Seob Eom, et al (2009) Role of the Rice Hexokinases OsHXK5 and OsHXK6 as Glucose Sensors1[C][W]. Plant Physiology 149:745-759 2. Jung-Il Cho, Nayeon Ryoo, Seho Ko Sang-Kyu Lee, et al (2006) Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.). Planta 224: 598–611

Structured Information

Gene Name

Os01g0742500

Description

Similar to Hexokinase

Version

NM_001050749.1 GI:115439868 GeneID:4326547

Length

4329 bp

Definition

Oryza sativa Japonica Group Os01g0742500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:32765472..32769800

Sequence Coding Region

32765921..32766268,32766361..32766442,32766656..32766786,32766860..32766958,32767099..32767254
,32767465..32767539,32768142..32768324,32768421..32768571,32769320..32769615

Expression

GEO Profiles:Os01g0742500

Genome Context

<gbrowseImage1> name=NC_008394:32765472..32769800 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:32765472..32769800 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaaggggacggtagtggggacggcggtggtggtgtgcgctgcagcggccgcggcggttggggtggcggtggtggtgtcgcggaggaggaggagcaagcgggaggcggaggaggagcggcggaggagggccgccgctgtgatcgaggaggtggagcagaggttctcgacgcccacggcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcggcctccgcgccgaccctcacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccggggatgagcacggactgttctatgctctcgatcttgggggcaccaatttccgtgttatacgtgttcagcttggaggaagggaaaagcgtgttgttagtcaacagtacgaagaggttgccattccacctcacctgatggttgggacttctatggaactgtttgacttcattgcggctgagttggaaagttttgtcaagaccgagggagaggatttccacttgccagagggcaggcagagagagttaggcttcaccttttctttcccagtgcaccaaacatcaatatcatcaggcactcttattaagtggacaaagggattttccatcaatggcacggtgggggaagatgttgtggctgaattgagcagggctatggaaaggcaagggcttgatatgaaagttacagctcttgttaatgacactgtaggcacattggctggcggaagatatgttgataatgacgttgctgctgctgtaatattaggcactggcacaaacgcagcctacgtggagcatgcaaatgcaattccaaaatggactggattactacctagatcaggaaatatggtgattaacatggaatggggaaacttcaagtcagaaaggcttcctcgttcagattacgataatgccttggactttgaaagtttaaacccaggcgagcagatatatgaaaagatgatttccggcatgtatcttggagagattgtgcgcagaatcttgcttaagcttgctcatgatgcttccttgtttggagatgttgttccaacaaagctggagcagcgctttatactgaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaacacctgggagctaagctgaaggatatcctgggggtcgctgatacttccctggaagcacgatacatcacccttcatgtctgcgacctcgttgcagagagaggtgcacgcttagctgctgctggtatatatggcattctaaagaagctgggcagggacagagtgccaagtgacggtagtcaaaagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcagaacctgcctagaagcaacgcttgcagacctgcttggagaggaggctgcctcatcagttgttgtcaagttggcaaacgatggctctggcatcggagctgcacttcttgcagcatctcactcccagtatgctagcgtcgagtag</cdnaseq>

Protein Sequence

<aaseq>MGKGTVVGTAVVVCAAAAAAVGVAVVVSRRRRSKREAEEERRRR AAAVIEEVEQRFSTPTALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEH GLFYALDLGGTNFRVIRVQLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELE SFVKTEGEDFHLPEGRQRELGFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAE LSRAMERQGLDMKVTALVNDTVGTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPK WTGLLPRSGNMVINMEWGNFKSERLPRSDYDNALDFESLNPGEQIYEKMISGMYLGEI VRRILLKLAHDASLFGDVVPTKLEQRFILRTPDMSAMHHDTSHDLKHLGAKLKDILGV ADTSLEARYITLHVCDLVAERGARLAAAGIYGILKKLGRDRVPSDGSQKQRTVIALDG GLYEHYKKFRTCLEATLADLLGEEAASSVVVKLANDGSGIGAALLAASHSQYASVE</aaseq>

Gene Sequence

<dnaseqindica>3533..3880#3359..3440#3015..3145#2843..2941#2547..2702#2262..2336#1477..1659#1230..1380#186..481#agaggagagagactgagggagggaggcaggaggaaggaggaggaggaggacgctgcagtggtgggtggcgtagctcccgatccgggaagccgacccggtctgggggatttgctcctggcgcgcgctcgatcgagagggaggccagggttgggttggggggagcgtgaagaagcgcgcgcgcggctatggggaaggggacggtagtggggacggcggtggtggtgtgcgctgcagcggccgcggcggttggggtggcggtggtggtgtcgcggaggaggaggagcaagcgggaggcggaggaggagcggcggaggagggccgccgctgtgatcgaggaggtggagcagaggttctcgacgcccacggcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcggcctccgcgccgaccctcacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccgggtaggcctccctccgctccgcttgtgcgatttttatgatttctggggtgtacgtgacacgagaaagcttgggaatagttgttactgtgttcgcgaggggtgtttctcttcgggggcgaatcggttggaaatccctagcggcttagcgcttgcttaggttcggatttggcataaatgtggcattgatcttcggttgttgagatggaggtgcgacatattgatatcaagagcactgtgccttgacacggccttttagctcttttcttattgatcacggaagaatgatgagacctattcgtttcctatggaattttgatctactgagtggaggtttctcacggtggtagcagaaagtggccaccaggatagacttgacataatttttttttcgcagtgaagactccagacagaattataaaatgaacaattaggttccggtcacttttgacaactatatatatctgtgtgtccattttgtaatttgtgccttcatgctgggcttacgatcagtcgatcacagaacaatcgttcttttttttgtaccatgtgaattttgtaggaaatgtcatgaaaggtttatgaataagtttagagaaagaaatggtcaaggactcgaggcttaaaagtttcagtgagtttgacagtttattatatgtatccataggcgtatggaaaatgaaaaatgttgagcctatcacttcatgaaatcttcttttatgcttcctctgatttgcatgccacttgtgcagggatgagcacggactgttctatgctctcgatcttgggggcaccaatttccgtgttatacgtgttcagcttggaggaagggaaaagcgtgttgttagtcaacagtacgaagaggttgccattccacctcacctgatggttgggacttctatggtcagtggcttattcctttcaactgttatgtttcaattctcctgtgtttgcacaatttctttcatggttactcaaatttcagaaatatgagtacaggaactgtttgacttcattgcggctgagttggaaagttttgtcaagaccgagggagaggatttccacttgccagagggcaggcagagagagttaggcttcaccttttctttcccagtgcaccaaacatcaatatcatcaggcactcttattaagtggacaaagggattttccatcaatggcacggtaaaattcgaatggccttagtataaatttcatggctaaatgatctaggaattatttattaccttgacgatcagtcttgattagaaaccacgttgtgtcagcaaacgaattctcactagctgtgtcacttttgacttttgggttccctgcattgaccaagtgaccagccgttgcccttcattttcctttcagaatatttggactgatgtttggttatccataaattaacatgtttggtaaagttattcttagatgtgatataaacgggacatggtggcatatgtccccatttatccaattcacaagtatcttataattgcttctaaatcctgcggcgattgtgaatgcagatgttacaattagagctgtgtttgctatacaacacttgtaaccataaaaaaatgtatttgcttatcctgcacttcttaaatttgaacctccaagaatgaagcactctagtcatatttctgtttcctacttttaatgtggcaatttctagcctctcaagacaaatgtggcatcaacactgcaatatcttttttaattttataatgttatgcccataattttgatgtatagactaatgatttctgtgaactcaggtgggggaagatgttgtggctgaattgagcagggctatggaaaggcaagggcttgatatgaaagttacagctcttgtaagtaaattcttggttcatgactctgttaaaattatttatcatctgaaactttcccatgcctgctactgctatatgctgatgggtaaatacattggcattcctatgaaaatgctgactttggagtttttcaatgttctatgagtttggatgtttactagtatatcaccagactgtgtcatgtaaattgacaactaatattttgcccaggttaatgacactgtaggcacattggctggcggaagatatgttgataatgacgttgctgctgctgtaatattaggcactggcacaaacgcagcctacgtggagcatgcaaatgcaattccaaaatggactggattactacctagatcaggaaatatggttagtgactgatttcgttatacttgtagcattaaatgtctttgaaccttgtataaatgtatgtatccacttcaacttctgcactggatgattgtcacatcaattaatattataacatttggatctttggtatgatgaaggtgattaacatggaatggggaaacttcaagtcagaaaggcttcctcgttcagattacgataatgccttggactttgaaagtttaaacccaggcgagcaggtattgtttattttatctttttattttccaactatatgtgggcatgaaagaatttcggtcttcttttcctcagatatatgaaaagatgatttccggcatgtatcttggagagattgtgcgcagaatcttgcttaagcttgctcatgatgcttccttgtttggagatgttgttccaacaaagctggagcagcgctttatactgaggtgcacttctatgtcccctatgttgatcatctaagtatctagcttttcatatatgcagcacagaactatcaaaataagataaaatttcaacatagactgtatggtgtgcattatgcgttccttgatcatggtagcacagaactatcaaaataagataaattcatgtaactatgtagaaaatttcttaacggaactccaattgtggtattgcaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaacacctgggagctaagctgaaggatatcctgggggtatgataatacatatcttgaaaataggatactatcaaatctaattttcaagaaccattgattacttacgatatgcctgaacttatgtttaggtcgctgatacttccctggaagcacgatacatcacccttcatgtctgcgacctcgttgcagagagaggtgcacgcttagctgctgctggtatatatggcattctaaagaagctgggcagggacagagtgccaagtgacggtagtcaaaagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcagaacctgcctagaagcaacgcttgcagacctgcttggagaggaggctgcctcatcagttgttgtcaagttggcaaacgatggctctggcatcggagctgcacttcttgcagcatctcactcccagtatgctagcgtcgagtagtaacaggagctcatgggactgagctcccagtgtagcttgttttcctcccattttccccgtttctttccaatgggagttcgtttccctcctgcgattcgcatctccttttgctattctgcagtcacataaacgagtgcctgtgcagcgggatgtagctagtatggcgccaaagagtttgcagttatcacatgaacaagcatttgcaactgcagggaagtgaaaacgggggcttgaatgatgccgttcttttcctgcaaattattttccccctttccctgtaagtttgtattgtgatgcgatgtcgcaaaccaatcacagcggtttcgcgtgtagccttttgtcattcagatttcagaataaagagggggacataatttcacttttcgtatgtcagtttgaactatgtatgtactcttacacactggtatcaaagctcaaatgatctgatc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0742500, RefSeq:Os01g0742500