Difference between revisions of "Os11g0117400"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 5: Line 5:
 
Please input function information here.
 
Please input function information here.
  
 +
WRKY genes encode transcription factors that are involved in the regulation of various biological processes. These zinc-finger proteins, especially those members mediating stress responses, are uniquely expanded in plants.
 
overexpression of the OsWRKY89 gene enhanced resistance to the rice blast fungus and white-backed planthopper as well as tolerance to UV-B irradiation. These results suggest that OsWRKY89 plays an important role in response to biotic and abiotic stresses.
 
overexpression of the OsWRKY89 gene enhanced resistance to the rice blast fungus and white-backed planthopper as well as tolerance to UV-B irradiation. These results suggest that OsWRKY89 plays an important role in response to biotic and abiotic stresses.
  

Revision as of 02:37, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

WRKY genes encode transcription factors that are involved in the regulation of various biological processes. These zinc-finger proteins, especially those members mediating stress responses, are uniquely expanded in plants. overexpression of the OsWRKY89 gene enhanced resistance to the rice blast fungus and white-backed planthopper as well as tolerance to UV-B irradiation. These results suggest that OsWRKY89 plays an important role in response to biotic and abiotic stresses.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

1. Haihua Wang;Junjie Hao;Xujun Chen;Zhongna Hao;Xia Wang;Yonggen Lou;Youliang Peng;Zejian Guo

 Overexpression of rice WRKY89 enhances ultraviolet B tolerance and disease resistance in rice plants
 Plant Molecular Biology, 2007, 65(6): 799-815 

2. Christian A. Ross;Yue Liu;Qingxi J. Shen

 The WRKY Gene Family in Rice (Oryza sativa)
 Journal of Integrative Plant Biology, 2007, 49(6): 827-842 

3. 郝中娜;王海华;郭泽建

 水稻OsWRKY89基因启动子的表达特性
 中国水稻科学, 2006, 20(2): 125-130

Structured Information

Gene Name

Os11g0117400

Description

DNA-binding WRKY domain containing protein

Version

NM_001072123.2 GI:297611109 GeneID:4349611

Length

1015 bp

Definition

Oryza sativa Japonica Group Os11g0117400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:781474..782488

Sequence Coding Region

781474..781891,781997..782104,782198..782463

Expression

GEO Profiles:Os11g0117400

Genome Context

<gbrowseImage1> name=NC_008404:781474..782488 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:781474..782488 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatagagcaccaaaaggctctcatggtggagctgcgtggcatggtcatgccattacttccgagcgacaatgaacaagccaagcttgctcttcaactcttgggagatatattgagttgctcagataaggctatctccatgctagaacttggtggagacactaaaaagctgaccaatcttgttggaggtaagagaaaaggtgacaagcatagcatggacaaccacaacttggaggaggaagccaaagaaagtgttagcaagagaagaaagaatgcagaacacacaggttcaactgtggctcaagcacctcacaatgatggacatcaatggaggaagtatggtcagaaatggatctctagagcaaaacattccaggagctactataggtgtgccaatagtaaagtgcaaggctgtcctgctacaaagacagtgcaacaaatggattccagtggaaatggaacatcaaagttgttcaacgttgactactatggccaacacacatgcaggggagatggcatagccgatccatatgttgtcgacacagcccatcacagtatggaacctatcaatcaaaacgaatgcaatagccctacacttgaacacgaagcccatgaagttcaagatgaaagatttgaaaacttgtgtatggtacaaaatatgccagagtatttgatagattttgaattggagagagccttcgagtttattgtgaactcaccattgggttctgagcattggacgttcgatgattcaataagatgtgagcacagtccaatatgcatatggggatga</cdnaseq>

Protein Sequence

<aaseq>MIEHQKALMVELRGMVMPLLPSDNEQAKLALQLLGDILSCSDKA ISMLELGGDTKKLTNLVGGKRKGDKHSMDNHNLEEEAKESVSKRRKNAEHTGSTVAQA PHNDGHQWRKYGQKWISRAKHSRSYYRCANSKVQGCPATKTVQQMDSSGNGTSKLFNV DYYGQHTCRGDGIADPYVVDTAHHSMEPINQNECNSPTLEHEAHEVQDERFENLCMVQ NMPEYLIDFELERAFEFIVNSPLGSEHWTFDDSIRCEHSPICIWG</aaseq>

Gene Sequence

<dnaseqindica>598..1015#385..492#26..291#tagtgactgtcaagtagtgatcaacatgatagagcaccaaaaggctctcatggtggagctgcgtggcatggtcatgccattacttccgagcgacaatgaacaagccaagcttgctcttcaactcttgggagatatattgagttgctcagataaggctatctccatgctagaacttggtggagacactaaaaagctgaccaatcttgttggaggtaagagaaaaggtgacaagcatagcatggacaaccacaacttggaggaggaagccaaagaaagtgttagcaagagaaggtatatgtatataaatacatgccactagaggaatgtccactagcttatcattcattgctaacgaaatttgattgatcctcttgattatgatagaaagaatgcagaacacacaggttcaactgtggctcaagcacctcacaatgatggacatcaatggaggaagtatggtcagaaatggatctctagagcaaaacattccaggtataaatgagcatatgaactcctgtttatttccattcctcgaagcatattggttttatctaacagcaaaatatatacatctaatgagctcatttgcttaagcaggagctactataggtgtgccaatagtaaagtgcaaggctgtcctgctacaaagacagtgcaacaaatggattccagtggaaatggaacatcaaagttgttcaacgttgactactatggccaacacacatgcaggggagatggcatagccgatccatatgttgtcgacacagcccatcacagtatggaacctatcaatcaaaacgaatgcaatagccctacacttgaacacgaagcccatgaagttcaagatgaaagatttgaaaacttgtgtatggtacaaaatatgccagagtatttgatagattttgaattggagagagccttcgagtttattgtgaactcaccattgggttctgagcattggacgttcgatgattcaataagatgtgagcacagtccaatatgcatatggggatga</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0117400, RefSeq:Os11g0117400