Difference between revisions of "Os08g0566600"
Longkailian (talk | contribs) (→Function) |
Longkailian (talk | contribs) |
||
| Line 1: | Line 1: | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
| − | The rice Os08g0566600 was report as proton gradient regulation 5 ,which is is | + | The rice Os08g0566600 was report as proton gradient regulation 5 ,which is involved in electron flow in rice Photosystem I. It is essential for photoprotection. |
Revision as of 03:26, 28 May 2014
Please input one-sentence summary here.
The rice Os08g0566600 was report as proton gradient regulation 5 ,which is involved in electron flow in rice Photosystem I. It is essential for photoprotection.
Contents
Annotated Information
Function
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:
1.PGR5-dependent PSI cyclic electron transporthelps to restore the balance of the oxidation of chloroplasts.
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan
2.CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan
3.Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
4.National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
References
1. PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice Plant and Cell Physiology, 2012, 53(12): 2117-2126
Structured Information
| Gene Name |
Os08g0566600 |
|---|---|
| Description |
Similar to PGR5 |
| Version |
NM_001069077.1 GI:115477892 GeneID:4346358 |
| Length |
1075 bp |
| Definition |
Oryza sativa Japonica Group Os08g0566600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:28465852..28466926 |
| Sequence Coding Region |
28465967..28466239,28466430..28466534 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSAR PLRAPARMGNVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGA DAKQRQGLIRLAKKNGEKLGFLA</aaseq> |
| Gene Sequence |
<dnaseqindica>116..388#579..683#actccactccacccaccggattgctaacttgcttcctccgtccgcggccaccactttctcctctcctcctcagagcaagatcattcaagtataatcctgcctcctactagctataatggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtacgcacgtctactctactccgatcctcatcaattatagtacactagttttaattaattagctatcatcatctgccatgccatatatataagcaaattttgcaatcaaacatatcaatatgcttgctatctatcttgtgagtgagtgacttgtggccatcgatgatacggacggtactgcttgttgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctgatcgacatgcccttcctaattcctactagctcatttgattggtgtggatttcctctctgaatgaatgaatttcctgtagctagctagccagccgcgccttcctccctgcgtataaatgtgtcttgtgcgtacgtatacctcctcttctgaccttcaattccatccatccatgccatggcggcatgaacgaatgaattagtagtaagtaatacgcgcatgcatgaacgaatgaataatatactatataatgcgtgtatacagacactagcgctggctagcatgtatgatgatcatgatgtatatgtatgagactgagactgtatgtagccagttaagcgacatcattgccgtcaagctccaatcggatggatctggatctcctagtcaatcttt</dnaseqindica> |
| External Link(s) |
