Difference between revisions of "Os11g0104300"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
  
    ''DWARF53''(''D53'') encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses.
+
''DWARF53''(''D53'') encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses.
    The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment.
+
The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment.
    The ''D53'' gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.
+
The ''D53'' gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.
  
 
===Expression===
 
===Expression===

Revision as of 05:15, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Function

DWARF53D53) encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses. The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment. The D53 gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os11g0104300

Description

Clp, N terminal domain containing protein

Version

NM_001072059.2 GI:297611030 GeneID:4349543

Length

5140 bp

Definition

Oryza sativa Japonica Group Os11g0104300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:193178..198317

Sequence Coding Region

193383..194690

Expression

GEO Profiles:Os11g0104300

Genome Context

<gbrowseImage1> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatag</cdnaseq>

Protein Sequence

<aaseq>MPTPVAAARQCLSPAAVPALDAAVASSRRRAHAQTTSLHLISSL LAPPAPPLLRDALARARSAAYSPRVQLKALDLCFAVSLDRLPSVSASSSSSGAADEPP VSNSLMAAIKRSQANQRRNPDTFHFYHQAATAQTPAAVKVELSHLVLAILDDPVVSRV FAEAGFRSGDIKLAILRPAPPMPLLGRLPTRTRPPPLFLCSFAAADDADVPSPAGNLA GAGEENCRRIAEILSRGRNPMLVGVGAASAADDFAAASPYRIIHVDPNTIDRSDLGVA AAMASATSGLIISIGDLKQLVPDEDAEAQEKGRRVVAEVTRVLETHSKVGRVWVMGWS ATYETYLAFLSKFPLVDKDWDLQLLPITAVHAAATAGPAAAAAGLMPPATTVAAFSKP AARSSLFSSLLFTFVSMNSLCIRFYYHPFADCRAFFIVRMFLG</aaseq>

Gene Sequence

<dnaseqindica>206..1513#tcaattccttccttctttccatttattttcttttattttcccaagagaaagagggtgaggaggctccatccgcgaaaagctactcgaccaacccacctgccaccctgcactttccgttattctcatttcaaccctcgcattttttacactccgctccccatgccctgtgaaaactaattacaatccagtccttcaccggtcagcgatgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatagtagtgtatctgattaggtgtgctagtacgatttgcttatgttctttactaatttcattttttttaagtgttgatttgtgtgctttgcccattgtatggatatttttttcaacttgtgcaattgatttagtgtactactgtaattagaagcagcataggttgttaaaaaggcataaatctagaaaggtttgttttcttccactgcattttttttaaaaatgtttttacacggtcaatgatgtacaaccgtttttgtttaatgcgatggttgagttatgttctaagtgccatgttactcctgttatgttcttgttgagttatgaccgattcagttctgttaagtacgacaggagttgctggaaattttctcttctcagaagtgggttcctaatgtgttgtcatcagaaccttccagaccaacttccttctagatgctctgctgttagtcactacctgtgttatttactgatttctcagctcttttttcttttttgcctttaggatatttaatgggattttcttcttataagccttttctctgtagtcctattcttgtaatatttttggattttattactacatatgtgtggccatgaaggagaggttctattgccggtgcagaatccatatgcatacacattttgaactgcttgataaagagagactaaagtgtaaaagtaaaataatacagcttgtgtactaagagatgcaatttcatggtaaaagagtggtgcttctgctgcagcacatctgttctttactgctgtaatgctcaaattgctgatagtttgggtcatatatgtgggcagagattatttgtcattaatatgtagtatcacctatagtgaattaccttgatgcatagggctagtgatttctgtcacaacatagtattgtatggcattttattcagctgtagaaatgttaatgcttaagcgttgctggtattaatgacaaagtgacatatacataactccaatataaagcaacgatatgcttgtgtcttgacctcatagtttcaaacttgttattgcagcttgatggactcctttgttccttttggaggctttctctgtgataactacgaagagaacagcctgacagcaaattcatgcccacaggccctgcggtgccagcagtgcaatgataaatatgagcaagaagttgcaactatcattagcgcaagtggcattacagctgaagaccatcaccagggaggtcttccttccctgctgcagaatggcagcatgatgggtcctaacaatggatttgatccagtcaaggtgtgaagctacctatgtcttttggaacatttatgttaagtactgaacgcagcaagcactgcttgttgatagatgaataatttttggtcgttggtataaaagatgcacagttttttttcagtgcaggctagagatgatcggatggtattgaattcaaaaatattgaatctacggaagaagtggaatgagtactgcctgcggctccaccaagaccaccagaggatcaacagagatccttacaaaccatttccgcgctatattggtgttcccactgacaaagaaagatcagcaaattcaagcaaaggttctgagtcagttggggttcaaaaggatgttattaaaccttgtgcggtgtctgctgtacattccagctcaactgcaaggcctatttcatctccatctgtcaccaacaaaagaaatgaagatcttgtattgaaccttcaagccaggcattccaagagtgatgaaaaccttcaagaaaggggcatgcaatcccaacatggcaccctgtcgaatgttgacaatccggatgatcatgtctcaccatcatctgctgcacctgtggaaactgacttggttttgggcacccctcgagagtgtagttcgaaaggttcaagttccacctgcagtaaacgtgtagaggattcagagaggtctgtccatctggtacccaagaaggtggatgatttaaatctgaagcatccacaactctctgttcaacctaattcctgctcctggagttccataaatgttgggaaaacatcacacagtacactacactcagtagcttcaggaggcttctctgcctttggccaatggcagaaacggtcacctcttgctgcacaaaattctgatctgagcaattacaagctacttgttgaacgcctgttcaaggtagttggaaggcaggaggaagccttgagtgctatttgtgaatccattgtgcggtgccggtcaacagagtcgcgccgtggtcctaacaggaatgacatctggttgtgttttcatggttctgacagcatggccaagaagagaatcgccgtggcacttgcagagctcatgcacggcagcaaagataacttgatttatctggacctaaaccttcaggattgggatgactccagtttcagagggaagactggcatagactgcattgtggagcagttgagcaagaaacggcaatctgttctcttccttgacaacattgatagagctgactgccttgttcaggatagtctatctgatgctattaagtctggcaggttccaagacatgcgaggcaaggtggttgacattaatgactcgattgtggttttgtcaagaagcatgatacagggcagcaaaaatgggttggaagagggcctttcattttctgaagaaaagattctggcaactcgcggacatcgactgaagatcctggttgaaccgggtagggcaatcaccagtggatgccctagtggtaaggtggtagtttccccaaggcattttctcaccaaaattcaagcatctttgtgctctggttccatcagcaagagaaagctcagtatttctgatgatcaggaaaagctacaagagtcgccaagcagttcaaagcgactgcacagaacatcgagtgtaccattcgacctgaacctccctgttgatgaagatgaaccccttgatgctgatgacgacagtagtagccatgaaaattcatatggcaacacagaaaaatccattgatgcccttttgcattcggttgatggatcaatcaactttaagccgtttgactttgataaacttgctgatgacatgctgcaggagttcagcaacatactcaggaaaaatctgggttctgagtgcatgttggagattgatgttggtgcaatggaacaaatacttgccgcagcatggaaatcagaggaggataggaaacctgtgccgacctggctggagcaggtttttgccaggagccttgacgagctgaagctcaagcgtaagcatgtgagtagctctacccttagactagtggcctgtgaggacacagtaccagcagtgaaaggagacggtttaggagttttgctcccgccaagaataattctagattgttgatgatattatctgtatagggatcgctgtaattatctgtagtccacaatagtatagcattatttgttggctaaataagctctagtctagctgatgcattgccttgggttctctaattagctactgccattactgtcatatcattttctacctcagggccttttccagatatatgggcatccgaatgtatattggttgtaactactatggattgtcaatatttgattgttctatatatacatggacacatggtgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0104300, RefSeq:Os11g0104300