Difference between revisions of "Os11g0104300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 9: Line 9:
  
 
===Phenotype===
 
===Phenotype===
The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment.
+
The rice (Oryza sativa) d53 mutant, which displays reduced height and increased tillering, as well as thinner stem and shorter crown root compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment. Further, measurement of SLs produced in the root exudates showed that d53 accumulated markedly higher levels of 2′-epi-5-deoxystrigol (epi-5DS), a native SL of rice, than the wild-type cultivar Norin 8.
  
  
 
[[File:phenotype of d53 mutant.jpg]]
 
[[File:phenotype of d53 mutant.jpg]]
 +
 +
===Characterization===
 +
''D53'' was mapped to the terminal region of the short arm of rice chromosome 11. A single-nucleotide substitution and 15-nucleotide deletion in the third exon of LOC_Os11g01330 in d53, which resulted in an amino acid substitution (R812T) and deletion of five amino acids (813GKTGI817).
  
 
===Expression===
 
===Expression===
 
The ''D53'' gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.
 
The ''D53'' gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 06:01, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Name

DWARF53D53)

Function

DWARF53D53) encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses. D53 can interact with transcriptional co-repressors known as TOPLESS-RELATED PROTEINS.

Phenotype

The rice (Oryza sativa) d53 mutant, which displays reduced height and increased tillering, as well as thinner stem and shorter crown root compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment. Further, measurement of SLs produced in the root exudates showed that d53 accumulated markedly higher levels of 2′-epi-5-deoxystrigol (epi-5DS), a native SL of rice, than the wild-type cultivar Norin 8.


Phenotype of d53 mutant.jpg

Characterization

D53 was mapped to the terminal region of the short arm of rice chromosome 11. A single-nucleotide substitution and 15-nucleotide deletion in the third exon of LOC_Os11g01330 in d53, which resulted in an amino acid substitution (R812T) and deletion of five amino acids (813GKTGI817).

Expression

The D53 gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os11g0104300

Description

Clp, N terminal domain containing protein

Version

NM_001072059.2 GI:297611030 GeneID:4349543

Length

5140 bp

Definition

Oryza sativa Japonica Group Os11g0104300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:193178..198317

Sequence Coding Region

193383..194690

Expression

GEO Profiles:Os11g0104300

Genome Context

<gbrowseImage1> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatag</cdnaseq>

Protein Sequence

<aaseq>MPTPVAAARQCLSPAAVPALDAAVASSRRRAHAQTTSLHLISSL LAPPAPPLLRDALARARSAAYSPRVQLKALDLCFAVSLDRLPSVSASSSSSGAADEPP VSNSLMAAIKRSQANQRRNPDTFHFYHQAATAQTPAAVKVELSHLVLAILDDPVVSRV FAEAGFRSGDIKLAILRPAPPMPLLGRLPTRTRPPPLFLCSFAAADDADVPSPAGNLA GAGEENCRRIAEILSRGRNPMLVGVGAASAADDFAAASPYRIIHVDPNTIDRSDLGVA AAMASATSGLIISIGDLKQLVPDEDAEAQEKGRRVVAEVTRVLETHSKVGRVWVMGWS ATYETYLAFLSKFPLVDKDWDLQLLPITAVHAAATAGPAAAAAGLMPPATTVAAFSKP AARSSLFSSLLFTFVSMNSLCIRFYYHPFADCRAFFIVRMFLG</aaseq>

Gene Sequence

<dnaseqindica>206..1513#tcaattccttccttctttccatttattttcttttattttcccaagagaaagagggtgaggaggctccatccgcgaaaagctactcgaccaacccacctgccaccctgcactttccgttattctcatttcaaccctcgcattttttacactccgctccccatgccctgtgaaaactaattacaatccagtccttcaccggtcagcgatgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatagtagtgtatctgattaggtgtgctagtacgatttgcttatgttctttactaatttcattttttttaagtgttgatttgtgtgctttgcccattgtatggatatttttttcaacttgtgcaattgatttagtgtactactgtaattagaagcagcataggttgttaaaaaggcataaatctagaaaggtttgttttcttccactgcattttttttaaaaatgtttttacacggtcaatgatgtacaaccgtttttgtttaatgcgatggttgagttatgttctaagtgccatgttactcctgttatgttcttgttgagttatgaccgattcagttctgttaagtacgacaggagttgctggaaattttctcttctcagaagtgggttcctaatgtgttgtcatcagaaccttccagaccaacttccttctagatgctctgctgttagtcactacctgtgttatttactgatttctcagctcttttttcttttttgcctttaggatatttaatgggattttcttcttataagccttttctctgtagtcctattcttgtaatatttttggattttattactacatatgtgtggccatgaaggagaggttctattgccggtgcagaatccatatgcatacacattttgaactgcttgataaagagagactaaagtgtaaaagtaaaataatacagcttgtgtactaagagatgcaatttcatggtaaaagagtggtgcttctgctgcagcacatctgttctttactgctgtaatgctcaaattgctgatagtttgggtcatatatgtgggcagagattatttgtcattaatatgtagtatcacctatagtgaattaccttgatgcatagggctagtgatttctgtcacaacatagtattgtatggcattttattcagctgtagaaatgttaatgcttaagcgttgctggtattaatgacaaagtgacatatacataactccaatataaagcaacgatatgcttgtgtcttgacctcatagtttcaaacttgttattgcagcttgatggactcctttgttccttttggaggctttctctgtgataactacgaagagaacagcctgacagcaaattcatgcccacaggccctgcggtgccagcagtgcaatgataaatatgagcaagaagttgcaactatcattagcgcaagtggcattacagctgaagaccatcaccagggaggtcttccttccctgctgcagaatggcagcatgatgggtcctaacaatggatttgatccagtcaaggtgtgaagctacctatgtcttttggaacatttatgttaagtactgaacgcagcaagcactgcttgttgatagatgaataatttttggtcgttggtataaaagatgcacagttttttttcagtgcaggctagagatgatcggatggtattgaattcaaaaatattgaatctacggaagaagtggaatgagtactgcctgcggctccaccaagaccaccagaggatcaacagagatccttacaaaccatttccgcgctatattggtgttcccactgacaaagaaagatcagcaaattcaagcaaaggttctgagtcagttggggttcaaaaggatgttattaaaccttgtgcggtgtctgctgtacattccagctcaactgcaaggcctatttcatctccatctgtcaccaacaaaagaaatgaagatcttgtattgaaccttcaagccaggcattccaagagtgatgaaaaccttcaagaaaggggcatgcaatcccaacatggcaccctgtcgaatgttgacaatccggatgatcatgtctcaccatcatctgctgcacctgtggaaactgacttggttttgggcacccctcgagagtgtagttcgaaaggttcaagttccacctgcagtaaacgtgtagaggattcagagaggtctgtccatctggtacccaagaaggtggatgatttaaatctgaagcatccacaactctctgttcaacctaattcctgctcctggagttccataaatgttgggaaaacatcacacagtacactacactcagtagcttcaggaggcttctctgcctttggccaatggcagaaacggtcacctcttgctgcacaaaattctgatctgagcaattacaagctacttgttgaacgcctgttcaaggtagttggaaggcaggaggaagccttgagtgctatttgtgaatccattgtgcggtgccggtcaacagagtcgcgccgtggtcctaacaggaatgacatctggttgtgttttcatggttctgacagcatggccaagaagagaatcgccgtggcacttgcagagctcatgcacggcagcaaagataacttgatttatctggacctaaaccttcaggattgggatgactccagtttcagagggaagactggcatagactgcattgtggagcagttgagcaagaaacggcaatctgttctcttccttgacaacattgatagagctgactgccttgttcaggatagtctatctgatgctattaagtctggcaggttccaagacatgcgaggcaaggtggttgacattaatgactcgattgtggttttgtcaagaagcatgatacagggcagcaaaaatgggttggaagagggcctttcattttctgaagaaaagattctggcaactcgcggacatcgactgaagatcctggttgaaccgggtagggcaatcaccagtggatgccctagtggtaaggtggtagtttccccaaggcattttctcaccaaaattcaagcatctttgtgctctggttccatcagcaagagaaagctcagtatttctgatgatcaggaaaagctacaagagtcgccaagcagttcaaagcgactgcacagaacatcgagtgtaccattcgacctgaacctccctgttgatgaagatgaaccccttgatgctgatgacgacagtagtagccatgaaaattcatatggcaacacagaaaaatccattgatgcccttttgcattcggttgatggatcaatcaactttaagccgtttgactttgataaacttgctgatgacatgctgcaggagttcagcaacatactcaggaaaaatctgggttctgagtgcatgttggagattgatgttggtgcaatggaacaaatacttgccgcagcatggaaatcagaggaggataggaaacctgtgccgacctggctggagcaggtttttgccaggagccttgacgagctgaagctcaagcgtaagcatgtgagtagctctacccttagactagtggcctgtgaggacacagtaccagcagtgaaaggagacggtttaggagttttgctcccgccaagaataattctagattgttgatgatattatctgtatagggatcgctgtaattatctgtagtccacaatagtatagcattatttgttggctaaataagctctagtctagctgatgcattgccttgggttctctaattagctactgccattactgtcatatcattttctacctcagggccttttccagatatatgggcatccgaatgtatattggttgtaactactatggattgtcaatatttgattgttctatatatacatggacacatggtgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0104300, RefSeq:Os11g0104300