Difference between revisions of "Os03g0597200"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Labs working on this gene)
Line 32: Line 32:
  
 
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China
 
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China
 +
Cloning ofYSA[[File:]];Complementation of theysaMutant;Chlorophyll and Carotenoid Content Measurement;Transmission Electron Microscopy;Subcellular Localization of GFP Proteins;Histochemical GUS Assay;RNA Preparation and RT-PCR Analysis.
  
 
==References==
 
==References==

Revision as of 07:17, 28 May 2014

Please input one-sentence summary here.

Annotated Information

The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.

Function

YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development.


Expression

Tissue localization YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.

Picture1.jpg


Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01.

Subcellular Localization of YSA Protein

The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.

Picture2.jpg

Evolution

Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1) You can also add sub-section(s) at will.

Labs working on this gene

Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China Cloning ofYSA[[File:]];Complementation of theysaMutant;Chlorophyll and Carotenoid Content Measurement;Transmission Electron Microscopy;Subcellular Localization of GFP Proteins;Histochemical GUS Assay;RNA Preparation and RT-PCR Analysis.

References

[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892

[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272

[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594

[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415

[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984

[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016

[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production[J].Plant Physiology, 159(1):227-238.

Structured Information

Gene Name

Os03g0597200

Description

Protein prenyltransferase domain containing protein

Version

NM_001057140.1 GI:115454008 GeneID:4333379

Length

5627 bp

Definition

Oryza sativa Japonica Group Os03g0597200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:22993430..22999056

Sequence Coding Region

22996530..22998758

Expression

GEO Profiles:Os03g0597200

Genome Context

<gbrowseImage1> name=NC_008396:22993430..22999056 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:22993430..22999056 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>

Protein Sequence

<aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>

Gene Sequence

<dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0597200, RefSeq:Os03g0597200