Difference between revisions of "Os01g0113350"

From RiceWiki
Jump to: navigation, search
(References)
(Evolution)
Line 17: Line 17:
  
 
===Evolution===
 
===Evolution===
   Thaumatin-like proteins appear to have originated in early eukaryotes and share a well-defined thaumatin-like protein domain[6].
+
   Thaumatin-like proteins appear to have originated in early eukaryotes and share a well-defined thaumatin-like protein domain<ref name="ref 6">. Evolutionary <br /> relationships within the thaumatin-like protein superfamily are not well understood. For example, a study of phylogenetic and structural relationships<ref name="ref 7">, suggested that plant PR5  proteins are paraphyletic in angiosperms and related to animal thaumatin-like proteins from insects and nematodes. However, another study indicated that thaumatin-like proteins are grouped into three major clades representing the animal, plant, and fungal kingdoms, respectively.Alignment analysis was done using 118 putative TLP sequences selected from ascomycete and basidiomycete fungi, moss, gymnosperms and angiosperms, plus animals as represented by nematodes and insects. The neighbor joining algorithm was used to construct a phylogenetic tree (Fig. 3). The topological pattern of the resulting tree indicates that the TLP superfamily is highly divergent, with the possibility of nine distinct groups (I–IX), each containing proteins with relatively high identity.
 +
... Figure 1
 +
[[File:figure.png|caption]]
 +
Phylogenetic analysis of 118 TLPs by the neighborjoining (NJ) method. ...
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 08:36, 28 May 2014

This gene encodes a thaumatin-like protein[1].

Annotated Information

Function

  This gene encodes a thaumatin-like protein. Thaumatin belongs to the pathogen response 5(PR5) family, and is only exclusively expressed in pathological conditions
such as paramicrobe infection or mechanical damage[2]. Therefore, it is thought that this protein is involved in acquired systematic resistance and the response to 

biotic stress; the latter process leads to microbe growth inhibition and spore germination reduction[2]. However, the precise mechanism in rice is unknown. In addition, this thaumatin-like peotein harbors ATP-binding potentiality and Serine/threonine-protein kinase activity according to the homology prediction[3]. And an attractive feature of this protein is its sweet flavor, and this feature may be used in food industry[4].

Expression

  This thaumatin-like protein is derived from the rice cultivar Nipponbare[5]. The name 'thaumatin-like' from its homology with thaumatin. Thaumatin is firstly  

extracted from the fruit Thaumatococcus daniellii growing in West Africa[4]. Thaumatin-like proteins are in diverse plants, and can be isolated from Hordeum vulgare (barley), Actinidia deliciosa(kiwifruit), Zea mays (maize), Pseudotsuga menziesii (douglas-firs), Nicotiana tabacum (tobacco), Solanum lycopersicum

(tomato) and Triticum sp. (wheat) . Most of the thaumatin-like protein have a molecular weight in the range of 18 kDa to 25 kDa and have a pH in the range from 4.5  to 5.5.[2]

Evolution

  Thaumatin-like proteins appear to have originated in early eukaryotes and share a well-defined thaumatin-like protein domain<ref name="ref 6">. Evolutionary 
relationships within the thaumatin-like protein superfamily are not well understood. For example, a study of phylogenetic and structural relationships<ref name="ref 7">, suggested that plant PR5 proteins are paraphyletic in angiosperms and related to animal thaumatin-like proteins from insects and nematodes. However, another study indicated that thaumatin-like proteins are grouped into three major clades representing the animal, plant, and fungal kingdoms, respectively.Alignment analysis was done using 118 putative TLP sequences selected from ascomycete and basidiomycete fungi, moss, gymnosperms and angiosperms, plus animals as represented by nematodes and insects. The neighbor joining algorithm was used to construct a phylogenetic tree (Fig. 3). The topological pattern of the resulting tree indicates that the TLP superfamily is highly divergent, with the possibility of nine distinct groups (I–IX), each containing proteins with relatively high identity.

... Figure 1 caption Phylogenetic analysis of 118 TLPs by the neighborjoining (NJ) method. ...

Labs working on this gene

1. Natural Resources Canada, Canadian Forest Service, Pacific Forestry Centre, Canada.
2. Department of Microbiology, Miami University, USA. 
3. Institute of Tropical Agriculture, Universiti Putra Malaysia, Malaysia.
4. National Institute of Crop Science, Tsukuba, Japan.
5. Institute for Plant Biology, University of Zurich, Switzerland.
6. Jayaraj Jayaraman Lab,  Department of Life Sciences, The University of the West Indies.

References

[1]Reimmann C, Dudler R. cDNA cloning and sequence analysis of a pathogen-induced thaumatin-like protein from rice (Oryza sativa). Plant Physiol. 1993;101(3):1113-1114.

[2]V. Borad, S. Sriram. Pathogenesis-Related Proteins for the Plant Protection. Asian J. Exp. Sci.2008;22(3):189-196.

[3]C7IXE4 (C7IXE4_ORYSJ),UniProtKB/TrEMBL:Os01g0113350 protein. [[1]]

[4]http://sphx.col.ynu.edu.cn/myfoodweb4/New_Folder/Thaumatin.htm.[[2]].

[5]NCBI Reference Sequence: NC_008394.4:Oryza sativa Japonica Group DNA, chromosome 1, complete sequence, cultivar: Nipponbare. [[3]]

[6]Liu JJ, Sturrock R, Ekramoddoullah AK.The superfamily of thaumatin-like proteins: its origin, evolution, and expression towards biological function. Plant Cell Rep. 2010;29(5):419-36.

Structured Information

Gene Name

Os01g0113350

Description

Thaumatin-like, pathogenesis-related 5 family protein

Version

NM_001185208.1 GI:297719550 GeneID:9271284

Length

2469 bp

Definition

Oryza sativa Japonica Group Os01g0113350, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:727977..730445

Sequence Coding Region

727977..729455,729750..729854,730389..730445

Expression

GEO Profiles:Os01g0113350

Genome Context

<gbrowseImage1> name=NC_008394:727977..730445 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:727977..730445 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcagtgtctacttgttgcactcaccatctcctacctctactcctcctcgctgccatagtcgccaccaccaccaccaaccacgccgccgccgccgccacgttgaacatcaccaacctatgccccttcaccgtgtggccggccgccgtgccggtgggcggcggcaggcggctcgacccgggcacgtcgtgggcgctcgacgtgcccgccggcgccgccccgggccgcgtgtgggcgcgcacgggctgcaccttcgacgccaccggcgccaacgggacgtgcctgacgggcgactgcggcggcgcgctgtcgtgcacgggctacggcgagccgccgcagacgctcgccgagttctcgctcggccaggccgacggccaggacctcttcgacatctccctcgtcgacggcttcaacgtgcccatggacttcctcccggcgccgccgccggatcagtcaccgccgtgcagcaaggggccacggtgtccggccaacgtcacggcacagtgccccggcgagctcagagctcatggaggctgcaacagcgcgtgcagagtgttcaagcaggacaaatactgctgcactggcaacgggacgaacacctgcgaacccaccacctactcgctgccatttgtgaggatgtgcccggacgcctatagctactccaggaacgatgcatccagcccagggttcacttgcccgtcaggtacaaattaccagatcatcttctgccccccaattgatctcacatcttcatctcctgcatcaattgctgttgctgcaaataacagacaaggaaaaaaggttattgccgggatcatcatagcttctgtaatcggctccacttcagtactcaccatggttatggcttacaccagcatcaagcgaagaacacgacggcgccgggagatacgtgaagaggagcaggagcttgaggagataacccttcaaggaatgccaaggaggttcacatttcagcagctacaggaagcaaccgatcagttcagagataagctcggtgaaggaggatttgggtcggttttcttgggacagattggagacgaaagagttgcggtgaaacgcctggatcgaaatggtcaggggatgagagaattcttggcagaggttcagacgatcggcagcatccaccatatcaatctggtgaggctgattggattctgtgcagagaaatcacagaggctcttggtttatgagcatatgcccaaaggttccttggacaggtggatctatcaccagcaaggtgctgctatttttcctagtgttcctcctctagattggcaaacacgatacaaaattattacccaagtagccaaaggtctctcataccttcatgaggagtgcacaaagagaattgctcacttggatgtaaaaccacaaaatatcctcctggatgacaaattcaatgctaaactctctgattttggactatgcaagctcattgatcgagataagagccaaatcgattgcaaaaggaggcctcaaatgtctgaggttgtaaaagcattggaaggcaccataagtatcgaaactaacatagttcatgattttgtcgcagtaaatccacctcagttttacaacctacctaccaccttatctgagaaaaaacaacaaccaacttag</cdnaseq>

Protein Sequence

<aaseq>MAAVSTCCTHHLLPLLLLAAIVATTTTNHAAAAATLNITNLCPF TVWPAAVPVGGGRRLDPGTSWALDVPAGAAPGRVWARTGCTFDATGANGTCLTGDCGG ALSCTGYGEPPQTLAEFSLGQADGQDLFDISLVDGFNVPMDFLPAPPPDQSPPCSKGP RCPANVTAQCPGELRAHGGCNSACRVFKQDKYCCTGNGTNTCEPTTYSLPFVRMCPDA YSYSRNDASSPGFTCPSGTNYQIIFCPPIDLTSSSPASIAVAANNRQGKKVIAGIIIA SVIGSTSVLTMVMAYTSIKRRTRRRREIREEEQELEEITLQGMPRRFTFQQLQEATDQ FRDKLGEGGFGSVFLGQIGDERVAVKRLDRNGQGMREFLAEVQTIGSIHHINLVRLIG FCAEKSQRLLVYEHMPKGSLDRWIYHQQGAAIFPSVPPLDWQTRYKIITQVAKGLSYL HEECTKRIAHLDVKPQNILLDDKFNAKLSDFGLCKLIDRDKSQIDCKRRPQMSEVVKA LEGTISIETNIVHDFVAVNPPQFYNLPTTLSEKKQQPT</aaseq>

Gene Sequence

<dnaseqindica>1..1479#1774..1878#2413..2469#atggcggcagtgtctacttgttgcactcaccatctcctacctctactcctcctcgctgccatagtcgccaccaccaccaccaaccacgccgccgccgccgccacgttgaacatcaccaacctatgccccttcaccgtgtggccggccgccgtgccggtgggcggcggcaggcggctcgacccgggcacgtcgtgggcgctcgacgtgcccgccggcgccgccccgggccgcgtgtgggcgcgcacgggctgcaccttcgacgccaccggcgccaacgggacgtgcctgacgggcgactgcggcggcgcgctgtcgtgcacgggctacggcgagccgccgcagacgctcgccgagttctcgctcggccaggccgacggccaggacctcttcgacatctccctcgtcgacggcttcaacgtgcccatggacttcctcccggcgccgccgccggatcagtcaccgccgtgcagcaaggggccacggtgtccggccaacgtcacggcacagtgccccggcgagctcagagctcatggaggctgcaacagcgcgtgcagagtgttcaagcaggacaaatactgctgcactggcaacgggacgaacacctgcgaacccaccacctactcgctgccatttgtgaggatgtgcccggacgcctatagctactccaggaacgatgcatccagcccagggttcacttgcccgtcaggtacaaattaccagatcatcttctgccccccaattgatctcacatcttcatctcctgcatcaattgctgttgctgcaaataacagacaaggaaaaaaggttattgccgggatcatcatagcttctgtaatcggctccacttcagtactcaccatggttatggcttacaccagcatcaagcgaagaacacgacggcgccgggagatacgtgaagaggagcaggagcttgaggagataacccttcaaggaatgccaaggaggttcacatttcagcagctacaggaagcaaccgatcagttcagagataagctcggtgaaggaggatttgggtcggttttcttgggacagattggagacgaaagagttgcggtgaaacgcctggatcgaaatggtcaggggatgagagaattcttggcagaggttcagacgatcggcagcatccaccatatcaatctggtgaggctgattggattctgtgcagagaaatcacagaggctcttggtttatgagcatatgcccaaaggttccttggacaggtggatctatcaccagcaaggtgctgctatttttcctagtgttcctcctctagattggcaaacacgatacaaaattattacccaagtagccaaaggtctctcataccttcatgaggagtgcacaaagagaattgctcacttggatgtaaaaccacaaaatatcctcctggatgacaaattcaatgctaaactctctgattttggactatgcaagctcattgatcgagataagagccaagtgattacaagaatgagaggcacacctggatatttagctcctgaatggctgacatcgcagatcacagaaaaggcagatgtctatagctttggcatagtagtcatggaaatcatcagcggaagaaagaatgttgacacttcccggtctgaacagagcatccatctaattaccttattgcaagaaaaggtgaagagtgatcagttggtagatttgattgacaaagataataatgacatgcaagtacacgagcaagaagtaatagagatgatgaaatttgcaatgtggtgtttgcagatcgattgcaaaaggaggcctcaaatgtctgaggttgtaaaagcattggaaggcaccataagtatcgaaactaacatagttcatgattttgtcgcagtaaatccagtaagctttggttttactgcagttgtgggctcagctccacctcttgcctcagatctatccggacccaggtgactgacgcaattttgatggtatactagaacatgtgcgcttttgggtcagaaaaaggcatagcatatacgctgttgcattctcagaaaactataatgtgatagcatcataccttcaaatcatttacattttttaatattgcaattttcgttcaagaagaacatctcaatattgtttgattgtttctgttgaacttgccctattagcaaatctgatcctggttcatacatgtgaaaccaatagctcttcttacatatcaaaatggtcatagctctcatggcactttcaaccataattcagtagtactttctcatggcacaaatacaacttttatcgtatgcaaatgaatagcgtaccacaagatcacatttttctcgttccagctttatactctgttattccctaaaaaaaatcactttcaaattacaacaatgcgatgaaacatctgtttacaacaatatgtagcctcagttttacaacctacctaccaccttatctgagaaaaaacaacaaccaacttag</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0113350, RefSeq:Os01g0113350