Difference between revisions of "Os01g0113350"
Biotitan2014 (talk | contribs) (→Evolution) |
Biotitan2014 (talk | contribs) (→Evolution) |
||
| Line 6: | Line 6: | ||
This gene encodes a thaumatin-like protein. Thaumatin belongs to the pathogen response 5(PR5) family, and is only exclusively expressed in pathological | This gene encodes a thaumatin-like protein. Thaumatin belongs to the pathogen response 5(PR5) family, and is only exclusively expressed in pathological | ||
conditionssuch as paramicrobe infection or mechanical damage[2]. Therefore, it is thought that this protein is involved in acquired systematic resistance and | conditionssuch as paramicrobe infection or mechanical damage[2]. Therefore, it is thought that this protein is involved in acquired systematic resistance and | ||
| − | the response to biotic stress; the latter process leads to microbe growth inhibition and spore germination reduction[2]. However, the precise mechanism in rice | + | the response to biotic stress; the latter process leads to microbe growth inhibition and spore germination reduction[2]. However, the precise mechanism in rice is unknown. In addition, this thaumatin-like peotein harbors ATP-binding potentiality and Serine/threonine-protein kinase activity according to the homology prediction[3]. And an attractive feature of this protein is its sweet flavor, and this feature may be used in food industry[4]. |
| − | addition, this thaumatin-like peotein harbors ATP-binding potentiality and Serine/threonine-protein kinase activity according to the homology prediction[3]. And an | + | --- |
| − | attractive feature of this protein is its sweet flavor, and this feature may be used in food industry[4]. | ||
| − | |||
===Expression=== | ===Expression=== | ||
| − | This thaumatin-like protein is derived from the rice cultivar Nipponbare[5]. The name 'thaumatin-like' from its homology with thaumatin. Thaumatin is firstly | + | This thaumatin-like protein is derived from the rice cultivar Nipponbare[5]. The name 'thaumatin-like' from its homology with thaumatin. Thaumatin is firstly |
| − | extracted from the fruit ''Thaumatococcus daniellii'' growing in West Africa[4]. Thaumatin-like proteins are in diverse plants, and can be isolated from Hordeum | + | extracted from the fruit ''Thaumatococcus daniellii'' growing in West Africa[4]. Thaumatin-like proteins are in diverse plants, and can be isolated from Hordeum |
| − | vulgare (barley), Actinidia deliciosa(kiwifruit), Zea mays (maize), Pseudotsuga menziesii (douglas-firs), Nicotiana tabacum (tobacco), Solanum lycopersicum | + | vulgare (barley), Actinidia deliciosa(kiwifruit), Zea mays (maize), Pseudotsuga menziesii (douglas-firs), Nicotiana tabacum (tobacco), Solanum lycopersicum |
| − | (tomato) and Triticum sp. (wheat) . Most of the thaumatin-like protein have a molecular weight in the range of 18 kDa to 25 kDa and have a pH in the range from 4.5 to 5.5.[2] | + | (tomato) and Triticum sp. (wheat) . Most of the thaumatin-like protein have a molecular weight in the range of 18 kDa to 25 kDa and have a pH in the range from 4.5 to 5.5.[2] |
| + | --- | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 08:45, 28 May 2014
This gene encodes a thaumatin-like protein[1].
Contents
Annotated Information
Function
This gene encodes a thaumatin-like protein. Thaumatin belongs to the pathogen response 5(PR5) family, and is only exclusively expressed in pathological conditionssuch as paramicrobe infection or mechanical damage[2]. Therefore, it is thought that this protein is involved in acquired systematic resistance and the response to biotic stress; the latter process leads to microbe growth inhibition and spore germination reduction[2]. However, the precise mechanism in rice is unknown. In addition, this thaumatin-like peotein harbors ATP-binding potentiality and Serine/threonine-protein kinase activity according to the homology prediction[3]. And an attractive feature of this protein is its sweet flavor, and this feature may be used in food industry[4].
---
Expression
This thaumatin-like protein is derived from the rice cultivar Nipponbare[5]. The name 'thaumatin-like' from its homology with thaumatin. Thaumatin is firstly
extracted from the fruit Thaumatococcus daniellii growing in West Africa[4]. Thaumatin-like proteins are in diverse plants, and can be isolated from Hordeum vulgare (barley), Actinidia deliciosa(kiwifruit), Zea mays (maize), Pseudotsuga menziesii (douglas-firs), Nicotiana tabacum (tobacco), Solanum lycopersicum
(tomato) and Triticum sp. (wheat) . Most of the thaumatin-like protein have a molecular weight in the range of 18 kDa to 25 kDa and have a pH in the range from 4.5 to 5.5.[2]
---
Evolution
Thaumatin-like proteins appear to have originated in early eukaryotes and share a well-defined thaumatin-like protein domain[6]. Evolutionary
relationships within the thaumatin-like protein superfamily are not well understood. For example, a study of phylogenetic and structural relationships[7], suggested that plant PR5 proteins are paraphyletic in angiosperms and related to animal thaumatin-like proteins from insects and nematodes. However, another study indicated that thaumatin-like proteins are grouped into three major clades representing the animal, plant, and fungal kingdoms, respectively.Alignment analysis was done using 118 putative TLP sequences selected from ascomycete and basidiomycete fungi, moss, gymnosperms and angiosperms, plus animals as represented by nematodes and insects. The neighbor joining algorithm was used to construct a phylogenetic tree (Fig. 3). The topological pattern of the resulting tree indicates that the TLP superfamily is highly divergent, with the possibility of nine distinct groups (I–IX), each containing proteins with relatively high identity.
... Figure 1
Phylogenetic analysis of 118 TLPs by the neighborjoining (NJ) method. ...
Labs working on this gene
1. Natural Resources Canada, Canadian Forest Service, Pacific Forestry Centre, Canada. 2. Department of Microbiology, Miami University, USA. 3. Institute of Tropical Agriculture, Universiti Putra Malaysia, Malaysia. 4. National Institute of Crop Science, Tsukuba, Japan. 5. Institute for Plant Biology, University of Zurich, Switzerland. 6. Jayaraj Jayaraman Lab, Department of Life Sciences, The University of the West Indies.
References
[1]Reimmann C, Dudler R. cDNA cloning and sequence analysis of a pathogen-induced thaumatin-like protein from rice (Oryza sativa). Plant Physiol. 1993;101(3):1113-1114.
[2]V. Borad, S. Sriram. Pathogenesis-Related Proteins for the Plant Protection. Asian J. Exp. Sci.2008;22(3):189-196.
[3]C7IXE4 (C7IXE4_ORYSJ),UniProtKB/TrEMBL:Os01g0113350 protein. [[1]]
[4]http://sphx.col.ynu.edu.cn/myfoodweb4/New_Folder/Thaumatin.htm.[[2]].
[5]NCBI Reference Sequence: NC_008394.4:Oryza sativa Japonica Group DNA, chromosome 1, complete sequence, cultivar: Nipponbare. [[3]]
[6]Liu JJ, Sturrock R, Ekramoddoullah AK.The superfamily of thaumatin-like proteins: its origin, evolution, and expression towards biological function. Plant Cell Rep. 2010;29(5):419-36.
Structured Information
| Gene Name |
Os01g0113350 |
|---|---|
| Description |
Thaumatin-like, pathogenesis-related 5 family protein |
| Version |
NM_001185208.1 GI:297719550 GeneID:9271284 |
| Length |
2469 bp |
| Definition |
Oryza sativa Japonica Group Os01g0113350, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:727977..730445 |
| Sequence Coding Region |
727977..729455,729750..729854,730389..730445 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:727977..730445 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:727977..730445 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggcagtgtctacttgttgcactcaccatctcctacctctactcctcctcgctgccatagtcgccaccaccaccaccaaccacgccgccgccgccgccacgttgaacatcaccaacctatgccccttcaccgtgtggccggccgccgtgccggtgggcggcggcaggcggctcgacccgggcacgtcgtgggcgctcgacgtgcccgccggcgccgccccgggccgcgtgtgggcgcgcacgggctgcaccttcgacgccaccggcgccaacgggacgtgcctgacgggcgactgcggcggcgcgctgtcgtgcacgggctacggcgagccgccgcagacgctcgccgagttctcgctcggccaggccgacggccaggacctcttcgacatctccctcgtcgacggcttcaacgtgcccatggacttcctcccggcgccgccgccggatcagtcaccgccgtgcagcaaggggccacggtgtccggccaacgtcacggcacagtgccccggcgagctcagagctcatggaggctgcaacagcgcgtgcagagtgttcaagcaggacaaatactgctgcactggcaacgggacgaacacctgcgaacccaccacctactcgctgccatttgtgaggatgtgcccggacgcctatagctactccaggaacgatgcatccagcccagggttcacttgcccgtcaggtacaaattaccagatcatcttctgccccccaattgatctcacatcttcatctcctgcatcaattgctgttgctgcaaataacagacaaggaaaaaaggttattgccgggatcatcatagcttctgtaatcggctccacttcagtactcaccatggttatggcttacaccagcatcaagcgaagaacacgacggcgccgggagatacgtgaagaggagcaggagcttgaggagataacccttcaaggaatgccaaggaggttcacatttcagcagctacaggaagcaaccgatcagttcagagataagctcggtgaaggaggatttgggtcggttttcttgggacagattggagacgaaagagttgcggtgaaacgcctggatcgaaatggtcaggggatgagagaattcttggcagaggttcagacgatcggcagcatccaccatatcaatctggtgaggctgattggattctgtgcagagaaatcacagaggctcttggtttatgagcatatgcccaaaggttccttggacaggtggatctatcaccagcaaggtgctgctatttttcctagtgttcctcctctagattggcaaacacgatacaaaattattacccaagtagccaaaggtctctcataccttcatgaggagtgcacaaagagaattgctcacttggatgtaaaaccacaaaatatcctcctggatgacaaattcaatgctaaactctctgattttggactatgcaagctcattgatcgagataagagccaaatcgattgcaaaaggaggcctcaaatgtctgaggttgtaaaagcattggaaggcaccataagtatcgaaactaacatagttcatgattttgtcgcagtaaatccacctcagttttacaacctacctaccaccttatctgagaaaaaacaacaaccaacttag</cdnaseq> |
| Protein Sequence |
<aaseq>MAAVSTCCTHHLLPLLLLAAIVATTTTNHAAAAATLNITNLCPF TVWPAAVPVGGGRRLDPGTSWALDVPAGAAPGRVWARTGCTFDATGANGTCLTGDCGG ALSCTGYGEPPQTLAEFSLGQADGQDLFDISLVDGFNVPMDFLPAPPPDQSPPCSKGP RCPANVTAQCPGELRAHGGCNSACRVFKQDKYCCTGNGTNTCEPTTYSLPFVRMCPDA YSYSRNDASSPGFTCPSGTNYQIIFCPPIDLTSSSPASIAVAANNRQGKKVIAGIIIA SVIGSTSVLTMVMAYTSIKRRTRRRREIREEEQELEEITLQGMPRRFTFQQLQEATDQ FRDKLGEGGFGSVFLGQIGDERVAVKRLDRNGQGMREFLAEVQTIGSIHHINLVRLIG FCAEKSQRLLVYEHMPKGSLDRWIYHQQGAAIFPSVPPLDWQTRYKIITQVAKGLSYL HEECTKRIAHLDVKPQNILLDDKFNAKLSDFGLCKLIDRDKSQIDCKRRPQMSEVVKA LEGTISIETNIVHDFVAVNPPQFYNLPTTLSEKKQQPT</aaseq> |
| Gene Sequence |
<dnaseqindica>1..1479#1774..1878#2413..2469#atggcggcagtgtctacttgttgcactcaccatctcctacctctactcctcctcgctgccatagtcgccaccaccaccaccaaccacgccgccgccgccgccacgttgaacatcaccaacctatgccccttcaccgtgtggccggccgccgtgccggtgggcggcggcaggcggctcgacccgggcacgtcgtgggcgctcgacgtgcccgccggcgccgccccgggccgcgtgtgggcgcgcacgggctgcaccttcgacgccaccggcgccaacgggacgtgcctgacgggcgactgcggcggcgcgctgtcgtgcacgggctacggcgagccgccgcagacgctcgccgagttctcgctcggccaggccgacggccaggacctcttcgacatctccctcgtcgacggcttcaacgtgcccatggacttcctcccggcgccgccgccggatcagtcaccgccgtgcagcaaggggccacggtgtccggccaacgtcacggcacagtgccccggcgagctcagagctcatggaggctgcaacagcgcgtgcagagtgttcaagcaggacaaatactgctgcactggcaacgggacgaacacctgcgaacccaccacctactcgctgccatttgtgaggatgtgcccggacgcctatagctactccaggaacgatgcatccagcccagggttcacttgcccgtcaggtacaaattaccagatcatcttctgccccccaattgatctcacatcttcatctcctgcatcaattgctgttgctgcaaataacagacaaggaaaaaaggttattgccgggatcatcatagcttctgtaatcggctccacttcagtactcaccatggttatggcttacaccagcatcaagcgaagaacacgacggcgccgggagatacgtgaagaggagcaggagcttgaggagataacccttcaaggaatgccaaggaggttcacatttcagcagctacaggaagcaaccgatcagttcagagataagctcggtgaaggaggatttgggtcggttttcttgggacagattggagacgaaagagttgcggtgaaacgcctggatcgaaatggtcaggggatgagagaattcttggcagaggttcagacgatcggcagcatccaccatatcaatctggtgaggctgattggattctgtgcagagaaatcacagaggctcttggtttatgagcatatgcccaaaggttccttggacaggtggatctatcaccagcaaggtgctgctatttttcctagtgttcctcctctagattggcaaacacgatacaaaattattacccaagtagccaaaggtctctcataccttcatgaggagtgcacaaagagaattgctcacttggatgtaaaaccacaaaatatcctcctggatgacaaattcaatgctaaactctctgattttggactatgcaagctcattgatcgagataagagccaagtgattacaagaatgagaggcacacctggatatttagctcctgaatggctgacatcgcagatcacagaaaaggcagatgtctatagctttggcatagtagtcatggaaatcatcagcggaagaaagaatgttgacacttcccggtctgaacagagcatccatctaattaccttattgcaagaaaaggtgaagagtgatcagttggtagatttgattgacaaagataataatgacatgcaagtacacgagcaagaagtaatagagatgatgaaatttgcaatgtggtgtttgcagatcgattgcaaaaggaggcctcaaatgtctgaggttgtaaaagcattggaaggcaccataagtatcgaaactaacatagttcatgattttgtcgcagtaaatccagtaagctttggttttactgcagttgtgggctcagctccacctcttgcctcagatctatccggacccaggtgactgacgcaattttgatggtatactagaacatgtgcgcttttgggtcagaaaaaggcatagcatatacgctgttgcattctcagaaaactataatgtgatagcatcataccttcaaatcatttacattttttaatattgcaattttcgttcaagaagaacatctcaatattgtttgattgtttctgttgaacttgccctattagcaaatctgatcctggttcatacatgtgaaaccaatagctcttcttacatatcaaaatggtcatagctctcatggcactttcaaccataattcagtagtactttctcatggcacaaatacaacttttatcgtatgcaaatgaatagcgtaccacaagatcacatttttctcgttccagctttatactctgttattccctaaaaaaaatcactttcaaattacaacaatgcgatgaaacatctgtttacaacaatatgtagcctcagttttacaacctacctaccaccttatctgagaaaaaacaacaaccaacttag</dnaseqindica> |
| External Link(s) |