Difference between revisions of "Os01g0730700"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Annotated Information)
Line 11: Line 11:
 
Please input evolution information here.
 
Please input evolution information here.
  
You can also add sub-section(s) at will.
 
  
1、Department of Biotechnology, Interdisciplinary Program of Graduate School for Bioenergy and Biomaterials;
+
==Labs working on this gene==
2、Bioenergy Research Center, Chonnam National University, Gwangju, 500-757, Republic of Korea;
+
1.Department of Biotechnology, Interdisciplinary Program of Graduate School for Bioenergy and Biomaterials;
3、Departme nt of Biol ogical Sci ences, Uni versity of N evada;
+
2.Bioenergy Research Center, Chonnam National University, Gwangju, 500-757, Republic of Korea;
4、Bioinformatics Core, School of Life Sciences, University of Nevada
+
3.Departme nt of Biol ogical Sci ences, Uni versity of N evada;
 +
4.Bioinformatics Core, School of Life Sciences, University of Nevada
 +
 
 +
==References==
 +
1.Kiyoon Kang, Sangkyu Park, Uyanga Natsagdorj, Young Soon Kim and Kyoungwhan Back.Methanol is an endogenous elicitor molecule for the
 +
synthesis of tryptophan and tryptophan-derived secondary metabolites upon senescence of detached rice leaves.The Plant Journal (2011) 66, 247–257
 +
2.Zhen Xie,Zhong-Lin Zhang, Xiaolu Zou, Jie Huang,Paul Ruas, Daniel Thompson,and QingxiJ.Shen.Annotations and Functional Analyses of the Rice WRKY
 +
Gene Superfamily Reveal Positive a nd Negative Regulators of Abscisic Acid Signaling in Aleurone Cells.Plant Physiology(2005) Vol.137:176–189
 +
3.Ross CA, Liu Y, Shen QJ.The WRKY gene family in rice (Oryza sativa).(2007)J. Integr. Plant Biol.49(6),827−842.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 11:39, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.


Labs working on this gene

1.Department of Biotechnology, Interdisciplinary Program of Graduate School for Bioenergy and Biomaterials; 2.Bioenergy Research Center, Chonnam National University, Gwangju, 500-757, Republic of Korea; 3.Departme nt of Biol ogical Sci ences, Uni versity of N evada; 4.Bioinformatics Core, School of Life Sciences, University of Nevada

References

1.Kiyoon Kang, Sangkyu Park, Uyanga Natsagdorj, Young Soon Kim and Kyoungwhan Back.Methanol is an endogenous elicitor molecule for the synthesis of tryptophan and tryptophan-derived secondary metabolites upon senescence of detached rice leaves.The Plant Journal (2011) 66, 247–257 2.Zhen Xie,Zhong-Lin Zhang, Xiaolu Zou, Jie Huang,Paul Ruas, Daniel Thompson,and QingxiJ.Shen.Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive a nd Negative Regulators of Abscisic Acid Signaling in Aleurone Cells.Plant Physiology(2005) Vol.137:176–189 3.Ross CA, Liu Y, Shen QJ.The WRKY gene family in rice (Oryza sativa).(2007)J. Integr. Plant Biol.49(6),827−842.

Structured Information

Gene Name

Os01g0730700

Description

WRKY transcription factor 14 (WRKY14)

Version

NM_001050679.1 GI:115439728 GeneID:4324426

Length

1736 bp

Definition

Oryza sativa Japonica Group Os01g0730700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:32235960..32237695

Sequence Coding Region

32236503..32237121,32237255..32237595

Expression

GEO Profiles:Os01g0730700

Genome Context

<gbrowseImage1> name=NC_008394:32235960..32237695 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:32235960..32237695 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacggcgagtggagcgacggggcggcggtgtcgtcgccgacgatgtccggcggcggcgggcgggagcagatgaagggcggggaggacgtcgctgcggcggattgcccggggtcgccggtgtcaccgtcaccggcagctgctcagcggtcggcggctggggcggcggcgtcgcctagcgggaggtcgaggcggtcggcgcagaagcgggtggtgaccgtgccgctggccgacgtgaccgggccgcggccgaagggcgtcggggagggcaacacgccgaccgactcgtgggcgtggcggaagtacggccagaagcccatcaaaggctcaccctttccaagggcttactaccggtgcagcagctcgaaggggtgcccggcgaggaagcaggtggagaggagccggaacgacccggacacggtgatcgtcacctactccttcgagcacaaccactccgccacggtgcccagggcgcagaaccggcaggcggcgccgcagaagcccaaggcgcaggcctgcagtccgccggagccggtggtggaagtggaacccgaggaaacgcaccagtacggcgtcaccgccgggcctgccaccggtggcggcggcggcgcggcggccatcgaggtgcgcgacgagttccggtggctctacgacgtcgtgtccgtcccagccacgtcgacctcgccctccgacatcgacgcggccgacgagatgcagctgtacgatcagccgatgttctttggcggcgccgtcgtcggcacggccgcgctcctccccgacgagttcggcgacgtcggcgggttaggcggggaggggctgggcgaggaggaggcgttgttcgaggggctcggcgagctgccggagtgcgccatggtgttccggcggcgcgccggcgacgggctggagatgggaggaggggttaagatcgagcagccggcggagagcacggccatgacatga</cdnaseq>

Protein Sequence

<aaseq>MDGEWSDGAAVSSPTMSGGGGREQMKGGEDVAAADCPGSPVSPS PAAAQRSAAGAAASPSGRSRRSAQKRVVTVPLADVTGPRPKGVGEGNTPTDSWAWRKY GQKPIKGSPFPRAYYRCSSSKGCPARKQVERSRNDPDTVIVTYSFEHNHSATVPRAQN RQAAPQKPKAQACSPPEPVVEVEPEETHQYGVTAGPATGGGGGAAAIEVRDEFRWLYD VVSVPATSTSPSDIDAADEMQLYDQPMFFGGAVVGTAALLPDEFGDVGGLGGEGLGEE EALFEGLGELPECAMVFRRRAGDGLEMGGGVKIEQPAESTAMT</aaseq>

Gene Sequence

<dnaseqindica>575..1193#101..441#gtagctggcgctggtgacggcatccatccaagaactgcctccttgatccatccattcccggcggacagatcacgccgccggccggctcttgtgtatatatatggacggcgagtggagcgacggggcggcggtgtcgtcgccgacgatgtccggcggcggcgggcgggagcagatgaagggcggggaggacgtcgctgcggcggattgcccggggtcgccggtgtcaccgtcaccggcagctgctcagcggtcggcggctggggcggcggcgtcgcctagcgggaggtcgaggcggtcggcgcagaagcgggtggtgaccgtgccgctggccgacgtgaccgggccgcggccgaagggcgtcggggagggcaacacgccgaccgactcgtgggcgtggcggaagtacggccagaagcccatcaaaggctcaccctttccaaggtaaaatacacaccacgacacacgaatcgatgccatggcatcgaatatcgatcgagttcttttgtaagttttgccatgaattggaggggtttttgtgctgatctagctaggcttggggcttcgtgatgagcagggcttactaccggtgcagcagctcgaaggggtgcccggcgaggaagcaggtggagaggagccggaacgacccggacacggtgatcgtcacctactccttcgagcacaaccactccgccacggtgcccagggcgcagaaccggcaggcggcgccgcagaagcccaaggcgcaggcctgcagtccgccggagccggtggtggaagtggaacccgaggaaacgcaccagtacggcgtcaccgccgggcctgccaccggtggcggcggcggcgcggcggccatcgaggtgcgcgacgagttccggtggctctacgacgtcgtgtccgtcccagccacgtcgacctcgccctccgacatcgacgcggccgacgagatgcagctgtacgatcagccgatgttctttggcggcgccgtcgtcggcacggccgcgctcctccccgacgagttcggcgacgtcggcgggttaggcggggaggggctgggcgaggaggaggcgttgttcgaggggctcggcgagctgccggagtgcgccatggtgttccggcggcgcgccggcgacgggctggagatgggaggaggggttaagatcgagcagccggcggagagcacggccatgacatgatgctgacacagacaggtgggcccggtccggcctccaataagaccagacaagctcctgtagtttttggcttcttgttcacttgccaattgtcggttagtttttttccctcctcattttggttattctctacagtagcatacagaaaagaatcggtacaatattattattgcacactgttgattggagaaaggattgagagagacaagtcactttgtcaatggtttggttgaagatttttgttttctcctttggaaccatcaatggatacataaataaagattggaaaaaagaaacacagaaggattggaactccattttttgctctgaaaactctgcctatgtccttgtcatgttgcgcaaatggataacattgaattgttcattactacagaaaaaagttccacttaacgatttcgtgtcagacccaaattctgagcattgtctgcaatagaagggctgtctttgttcacgatctgatcgacggaacatcatgttatatatgaattgcaacgacagatgaatcaaataaaatgtaattttatt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0730700, RefSeq:Os01g0730700