Difference between revisions of "Os01g0710200"

From RiceWiki
Jump to: navigation, search
m
m
Line 1: Line 1:
 
This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.
 
This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.
 
==Annotated Information==
 
==Annotated Information==
 +
 
===Function===
 
===Function===
Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine catabolism. Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway.
+
Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting.
 +
In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway.
 +
Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put.
 +
 
  
 
===Expression===
 
===Expression===

Revision as of 12:20, 28 May 2014

This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.

Annotated Information

Function

Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting. In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway. Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put.


Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0710200

Description

Amine oxidase domain containing protein

Version

NM_001050573.1 GI:115439516 GeneID:4327828

Length

1539 bp

Definition

Oryza sativa Japonica Group Os01g0710200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:31269225..31270763

Sequence Coding Region

31269225..31270763

Expression

GEO Profiles:Os01g0710200

Genome Context

<gbrowseImage1> name=NC_008394:31269225..31270763 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:31269225..31270763 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</cdnaseq>

Protein Sequence

<aaseq>MVAKKPRVVVVGAGISGLAAAHRLCGAGGDRFEVAVVEAGDRVG GRILTSEFAGHRVEMGATWVQGVVGSPVYALARDAGALGEEEGRGLPYERMDGFPDRV LTVAEGGEVVDADTVAGPIEELYRGMMEAARAGEAGGGGGVEEYLRRGLRAYQAARSA GGGGGGGKELEEVDEALLAMHINRERTDTSADDLGDLDLTAEGEYRDFPGEHVTIPGG YSRVVERLAAALPPGTVRLGLRLRRLKWGGTPVRLHFADGAPPLTADHVILTVSLGVL KASLGNKDTAGVGAAAIAFDPPLPPFKREAVARLGFGVVNKLFMEVEAVAPSEPEDVA GVQPAAAGFPFLHMAFRGHVSKIPWWMRGTESICPVHAGSTVALAWFAGREAAHLESL PDDDVIRGAHATLDSFLPAAPRWRVRRIKRSGWATDPLFLGSYSYVAVGSSGDDLDRM AEPLPRGPDAAADERPPSPRLLFAGEATHRTHYSTTHAAYLSGVREANRLLQHYRGGA NHTT</aaseq>

Gene Sequence

<dnaseqindica>1..1539#atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0710200, RefSeq:Os01g0710200