Difference between revisions of "Os01g0710200"
m |
m |
||
| Line 3: | Line 3: | ||
===Function=== | ===Function=== | ||
| − | Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting. | + | Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting. |
| − | In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway. | + | In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway. |
| − | Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put. | + | Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put. |
Revision as of 12:36, 28 May 2014
This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.
Contents
Annotated Information
Function
Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting. In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway. Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0710200 |
|---|---|
| Description |
Amine oxidase domain containing protein |
| Version |
NM_001050573.1 GI:115439516 GeneID:4327828 |
| Length |
1539 bp |
| Definition |
Oryza sativa Japonica Group Os01g0710200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:31269225..31270763 |
| Sequence Coding Region |
31269225..31270763 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:31269225..31270763 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:31269225..31270763 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MVAKKPRVVVVGAGISGLAAAHRLCGAGGDRFEVAVVEAGDRVG GRILTSEFAGHRVEMGATWVQGVVGSPVYALARDAGALGEEEGRGLPYERMDGFPDRV LTVAEGGEVVDADTVAGPIEELYRGMMEAARAGEAGGGGGVEEYLRRGLRAYQAARSA GGGGGGGKELEEVDEALLAMHINRERTDTSADDLGDLDLTAEGEYRDFPGEHVTIPGG YSRVVERLAAALPPGTVRLGLRLRRLKWGGTPVRLHFADGAPPLTADHVILTVSLGVL KASLGNKDTAGVGAAAIAFDPPLPPFKREAVARLGFGVVNKLFMEVEAVAPSEPEDVA GVQPAAAGFPFLHMAFRGHVSKIPWWMRGTESICPVHAGSTVALAWFAGREAAHLESL PDDDVIRGAHATLDSFLPAAPRWRVRRIKRSGWATDPLFLGSYSYVAVGSSGDDLDRM AEPLPRGPDAAADERPPSPRLLFAGEATHRTHYSTTHAAYLSGVREANRLLQHYRGGA NHTT</aaseq> |
| Gene Sequence |
<dnaseqindica>1..1539#atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</dnaseqindica> |
| External Link(s) |