Difference between revisions of "Os01g0733200"
| Line 1: | Line 1: | ||
| − | The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and | + | The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica. |
| − | development in Oryza sativa ssp. japonica. | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice. Furthermore, OsHsfC1b is | + | OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />. |
| − | involved in the response to osmotic stress and is required for plant growth under non-stress | + | Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to |
| − | conditions. | + | class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control. |
===Expression=== | ===Expression=== | ||
| − | Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2. | + | Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />. |
| + | OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated | ||
| + | in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level. | ||
| + | OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them (Fig.1). As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs | |
| − | + | were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B (Fig.1)<ref name="ref3" />.[[File:tileshop.jpg]] | |
| − | |||
| − | |||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| Line 23: | Line 23: | ||
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France | CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France | ||
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China | State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China | ||
| + | National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China | ||
| + | State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China | ||
| + | Graduate School of the Chinese Academy of Sciences, Beijing 100039, China | ||
==References== | ==References== | ||
| − | 1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.(2009)Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica | + | 1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.(2009)Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17. |
| + | 2.Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300. | ||
| + | 3.Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590. | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 13:12, 28 May 2014
The rice OsHsfC1b gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
Contents
Annotated Information
Function
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice[1].The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress[2]. Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions[1].In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.
Expression
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2[1]. OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level. OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.
Evolution
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them (Fig.1). As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs
were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B (Fig.1)[3].
You can also add sub-section(s) at will.
Labs working on this gene
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China Graduate School of the Chinese Academy of Sciences, Beijing 100039, China
References
1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.(2009)Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17. 2.Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300. 3.Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.
Structured Information
| Gene Name |
Os01g0733200 |
|---|---|
| Description |
Similar to Heat shock transcription factor 29 (Fragment) |
| Version |
NM_001050695.1 GI:115439760 GeneID:4324158 |
| Length |
1210 bp |
| Definition |
Oryza sativa Japonica Group Os01g0733200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:32338331..32339540 |
| Sequence Coding Region |
32338482..32338730,32338840..32339343 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:32338331..32339540 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:32338331..32339540 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq> |
| Protein Sequence |
<aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq> |
| Gene Sequence |
<dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica> |
| External Link(s) |