Difference between revisions of "Os12g0476200"
(→Function) |
(→Function) |
||
| Line 6: | Line 6: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | The xa25, localized in the centromeric region of chromosome 12, mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth. It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals. | + | The xa25, localized in the centromeric region of chromosome 12(see Fig. 1)[[File:figure__1.jpg]], mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth. It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals. |
| + | Transgenic plants carrying dominant Xa25 was analysed for its responses to other Xoo strains at both seedling and adult stages. In seedling stage, the wild-type Minghui 63 carrying dominant Xa3/Xa26 and recessive xa25 was resistant to PXO339 and susceptible to PXO61, PXO341 and PXO99. The transgenic plants showed significantly increased susceptibility (P < 0.01) to PXO339 as compared | ||
| + | with the wild-type and the susceptible control plants (Zhenshan 97) and had the same level of susceptibility to PXO61, PXO341 and PXO99 (Fig. 4b). In the adult stage, the wild-type Minghui 63 was resistant to PXO339, moderately resistant to PXO61 and PXO341, and susceptible to PXO99 [[File:figure__2.jpg]]. Similar to the seedling stage, the transgenic plants only showed significantly increased sus- | ||
| + | ceptibility (P < 0.01) to PXO339 but not Xoo strains PXO61, PXO341 and PXO99 as compared with wild-type plants at adult stage (see Fig. 2). These results suggest that the recessive xa25 confers race-specific resistance to PXO339 at both seedling and adult stages. | ||
===Expression=== | ===Expression=== | ||
Revision as of 14:36, 28 May 2014
Please input one-sentence summary here.
Os01g0136400 is a new dominant gene, for bacterial blight resistance in rice, Xa25(t), which conferred resistance to Philippine race 9 (PXO339) of X.
Contents
Annotated Information
Function
The xa25, localized in the centromeric region of chromosome 12(see Fig. 1)
, mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth. It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals.
Transgenic plants carrying dominant Xa25 was analysed for its responses to other Xoo strains at both seedling and adult stages. In seedling stage, the wild-type Minghui 63 carrying dominant Xa3/Xa26 and recessive xa25 was resistant to PXO339 and susceptible to PXO61, PXO341 and PXO99. The transgenic plants showed significantly increased susceptibility (P < 0.01) to PXO339 as compared
with the wild-type and the susceptible control plants (Zhenshan 97) and had the same level of susceptibility to PXO61, PXO341 and PXO99 (Fig. 4b). In the adult stage, the wild-type Minghui 63 was resistant to PXO339, moderately resistant to PXO61 and PXO341, and susceptible to PXO99 
. Similar to the seedling stage, the transgenic plants only showed significantly increased sus-
ceptibility (P < 0.01) to PXO339 but not Xoo strains PXO61, PXO341 and PXO99 as compared with wild-type plants at adult stage (see Fig. 2). These results suggest that the recessive xa25 confers race-specific resistance to PXO339 at both seedling and adult stages.
Expression
Transformation of the dominant Xa25 into a resistant rice line carrying the recessive xa25 abolished its resistance to PXO339. The encoding proteins of recessive xa25 and its dominant allele Xa25 have eight amino acid differences. The expression of dominant Xa25 but not recessive xa25 was rapidly induced by PXO339 but not other Xoo strain infections. The nature of xa25-encoding protein and its expression pattern in comparison with its susceptible allele in rice–Xoo interaction indicate that the mechanism of xa25-mediated resistance appears to be different from that conferred by most of the characterized R proteins.
Evolution
Char- acterization of more R genes against Xoo will facilitate evaluation of this inference. In a previous study, we identi- fied and mapped a new R gene against Xoo in rice. This gene localized in rice chromosome 12 and was tentatively named as Xa25(t) (Chen, Wang & Zhang 2002).
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os12g0476200 |
|---|---|
| Description |
MtN3 and saliva related transmembrane protein family protein |
| Version |
NM_001073287.2 GI:297613156 GeneID:4352201 |
| Length |
3215 bp |
| Definition |
Oryza sativa Japonica Group Os12g0476200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 12:17446841..17450055 |
| Sequence Coding Region |
17448475..17448712,17448827..17448863,17449812..17449863 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008405:17446841..17450055 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008405:17446841..17450055 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggctggcctgtccctgcagcatccctgggcttttgccttcggcctccttggcaacctcatatccttcacgacctatctggcaccaatcccgacgttctaccggatctacaagagcaagtcgacggaggggttccagtcggtgccgtacgtggtggcgctcttcagcgccatgctgtggatcttctacgcgctgatcaagtccaacgaggccctcctcatcaccatcaacgccgccggttgcgtcatcgagaccatctacatcgtcatgtacctcgcctacgcccccaagaaggccaaggttcgatccatgtcatccaaaccctag</cdnaseq> |
| Protein Sequence |
<aaseq>MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEG FQSVPYVVALFSAMLWIFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVR SMSSKP</aaseq> |
| Gene Sequence |
<dnaseqindica>1344..1581#1193..1229#193..244#aagagttttcagccaacacattgaactcttcttcagagctctcccttccctccacaaagggggtctagggttagagtgtgtgtgtctgtgacaagttccaagctagcaacaacaagctcaattccttgcttgtttgcttccatattacactacatctcttcccttcaattaccccccttttagcacacaaaaatggctggcctgtccctgcagcatccctgggcttttgccttcggcctccttggtatatcatcatcacctaccacaactaagacattcccttcattgccaacattttacttctttttattagaaaccattgagtttgtacatataagctcagagttattacttgctggcagatacgcatagctagcgacgacatttagtgaggattacactttagtggtcatcatatataaaataataaaattgttgtgtttctttatttgttttttattttctagctagcttctttcagttattttcaacaaaaagaatttcttctagcacttttatttacagcagtttattatgtctatttgggcatattaattagctactagcgcataagctaaaaaccctactagccttccgaaggcaatatggatggtactcttgtagtaataagccaaaagctagatttgattttttttatttcttttggcttttgtctattagaattatacgcgcggcgccacccttaaaattgcaggcttaaaatccacaagcatataaactacaagggcctaagcatacttaatgagatgcacatagccatataatttttctgcttcttgttaaactatatatatacagcaagtcctcatcatttgtatgtatatcctacttgtggagcaaacattcgatcctttggtgcaacctctatatatttatgttgccatggagagagagtggaattaataggtcaagctatatagtactctaattaatgacatcatagtgcaccatgtaacacaataatttaaagaacaagttaaaagccaaggcacaatctttgttgcaaaggaaggcaagggctagacataaagtttgtaaacgtgtctatctatcacaacttatcacgtctggtcgctaccttagctgcctccatggggctctttactcgcattactttgccttttttcctttacaaaatcctgatcttgtttctgttcctttggctttgcaggcaacctcatatccttcacgacctatctggcaccaatgtaagtaactgaatttctacatgatatatacatatatagcttttgtgtaattttaattcccaatccgcaccgcgttccgtatccgataatatatgtgcataatattttatgcagcccgacgttctaccggatctacaagagcaagtcgacggaggggttccagtcggtgccgtacgtggtggcgctcttcagcgccatgctgtggatcttctacgcgctgatcaagtccaacgaggccctcctcatcaccatcaacgccgccggttgcgtcatcgagaccatctacatcgtcatgtacctcgcctacgcccccaagaaggccaaggttcgatccatgtcatccaaaccctagcactaccacagaaaccctatttcgatgccggtggggacttgggaaccaccctttgattctcgagtcgcaaccggcaccgatgagaggccccttacaggtgtcatcggttgtgaacaagaaccggcacctatataagattgttccatatttaccgttttgtagtagtaaaatataataattgacaagtatatatggttcgacgtcgtttttgcaggtgttcacgacgaagatcctgctgctgctgaacgtgggggtgttcggggtgatcctgctgctgacgctgctgctctcccatggcgagcagcgcgtcgtctccctcggctgggtctgcgtcgccttctccgtcagcgtctttgtcgcgccgctcagcatcatcgtatgtgcatatatacgatcagtcgtcgtcaatctctagctagctcatctttacttcgtgtcttggtttgatcgatcgatctcgttgctaactgaactgcttccatggacgatggatgcgatattgcagaagcgagtgatccagtcgaggagcgtggagtacatgcccttctccctctccctcacgctcaccctcagcgccgtcgtctggttcctctacggccttctcatcaaggacaaatacgtcgcggtaattattcaatcaattacctaattatttcttcaaatcacaaactgctcaattcaaatttatgtgtgtgaccacatgaattgtaattaagctaaaattgtgtgaatttttgcagcttcccaacatcctgggcttcacattcggtgtggtccagatggggctctacgtgttctacatgaacgcgacgccggtggccggcgaggggaaagaagggaaggggaagctggcggcggcggaggagctccccgtcgtcgtcaacgtcggcaagctcgccgccgccacgcccgacaggagcaccggcgccgtgcacgtgcacccagtcccgaggagctgcgcggcggaggcggcggcggccgagccggaggtgctcgtcgacattccgccgccgccgccgccgcgcgccgtcgaggtggccgccgtgtagggtccccggccggtcaacgcgtgcttgcatgggccatgcacgtgtgcagtaccacgtgccacgtacactttaatatgaactccagggcaaacttggaggagacaagctaccaccaattaattaacttaattattattactcatctttcccaaaatataattacttttagcctctaaaatttatctcaaaatatagcaacttcttcacctatattctcttataaaacaatcgtaaccttccattaattaaatttcttacatatatatttctcctcttatcaatcaatcccaactgcctttttttttcattttattcctgtaactttcgtaatatatccgtatatcctatctaaaacttattatattttgggatggtgatggtattatatatctttcttgcatgccatgcaactagagacgggggaagctatgtgtaatgtatgtgcatgtgtttctctggtgttggtttccgcttctgttgtattcatttgtatcggtcaatgggtatctattattcctaattagttccttgtacttgtaatgtatgtcaaaattaataaaaatgtaatcgataaatatctcttct</dnaseqindica> |
| External Link(s) |
