Difference between revisions of "User talk:Duweili13"

From RiceWiki
Jump to: navigation, search
(Created page with "==Annotated Information== ===Function=== Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) ...")
 
 
Line 1: Line 1:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) and intracellular non-RD (arginine - aspartate) kinase domains. XA21-mediated immunity is activated upon recognition of a 194-amino acid protein designated Ax21 (activator of XA21-mediated innate immunity). Non-RD kinases usually carry a cysteine or glycine in place of the arginine and can induces inflammatory responses by both NLRs and TLRs. XA21 biogenesis occurs in the endoplasmic reticulum (ER) and the phosphorylation state of XA21 is critical for XA21-mediated signaling.  
+
  Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM)  
 +
  and intracellular non-RD (arginine - aspartate) kinase domains. XA21-mediated immunity is activated upon recognition of a  
 +
  194-amino acid protein designated Ax21 (activator of XA21-mediated innate immunity). Non-RD kinases usually carry a cysteine or  
 +
  glycine in place of the arginine and can induces inflammatory responses by both NLRs and TLRs. XA21 biogenesis occurs in the  
 +
  endoplasmic reticulum (ER) and the phosphorylation state of XA21 is critical for XA21-mediated signaling.  
  
 
===Localization===
 
===Localization===
Line 7: Line 11:
  
 
===Evolution===
 
===Evolution===
  Genome analyses have revealed an approximately 10-fold greater number of non-RD receptor kinases in rice (328) than inArabidopsis (35). These results suggest that rice has a vastly expanded capacity to recognize conserved microbial signature molecules.
+
  Genome analyses have revealed an approximately 10-fold greater number of non-RD receptor kinases  
 +
in rice (328) than inArabidopsis (35). These results suggest that rice has a vastly expanded capacity to  
 +
recognize conserved microbial signature molecules.
  
  

Latest revision as of 01:21, 29 May 2014

Annotated Information

Function

 Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) 
 and intracellular non-RD (arginine - aspartate) kinase domains. XA21-mediated immunity is activated upon recognition of a 
 194-amino acid protein designated Ax21 (activator of XA21-mediated innate immunity). Non-RD kinases usually carry a cysteine or 
 glycine in place of the arginine and can induces inflammatory responses by both NLRs and TLRs. XA21 biogenesis occurs in the 
 endoplasmic reticulum (ER) and the phosphorylation state of XA21 is critical for XA21-mediated signaling. 

Localization

XA21 is a kind of transmembrane protein. 

Evolution

Genome analyses have revealed an approximately 10-fold greater number of non-RD receptor kinases 
in rice (328) than inArabidopsis (35). These results suggest that rice has a vastly expanded capacity to 
recognize conserved microbial signature molecules.


Labs working on this gene

  • Department of Ecology and Evolution, University of Chicago, 1101 E. 57th Street, Chicago, IL 60637, USA
  • Department of Plant Pathology, University of California, Davis, CA 95616, USA
  • Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602,Japan
  • Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan

References

  • Song, W.Y.et al.(1995) A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21.Science270, 1804–1806
  • Dardick, C. and Ronald, P. (2006) Plant and animal pathogen recognition receptors signal through non-RD kinases.PLoS Pathog. 2, e2
  • Towb, P.et al.(2009) Tube Is an IRAK-4 homolog in a Toll pathway adapted for development and immunity.J. Innate Immun.1, 309–321
  • Park, C.J. et al. (2010) Elucidation of XA21-mediated innate immunity. Cell. Microbiol.12, 1017–1025

Structured information

Gene Name

xa21

Description

receptor kinase-like protein

Version

AY885788.1 GI: 63098480

Length

1091 bp

Definition

Oryza sativa (indica cultivar-group) isolate Xa21 receptor kinase-like protein(Xa21) gene, partial cds.

Source

Oryza sativa Indica Group (long-grained rice)

Chromosome

Chromosome 11

Location

{{{AP}}}

Sequence Coding Region

{{{CDS}}}

Expression

GEO Profiles:xa21

Genome Context

{{{GCID}}}

Gene Structure

{{{GSID}}}

Coding Sequence

<cdnaseq>TTGATAAGATCACAGGAAGCATTCCAAAGGATATTGGCAATCTTATTGGCTTACAACATCTCTATCTCTGCAACAACAATTTCAGAGGGTCTCTTCCATCATCGTTGGGCAGGCTTAGAAACTTAGGCATTCTAGTCGCCTACGAAAACAACTTGAGCGGTTCGATCCCATTGGCCATAGGAAATCTTACTGAACTTAATATCTTACTGCTCGGCACCAACAAATTCAGTGGTTGGATACCATACACACTCTCAAACCTCACAAACTTGTTGTCATTAGGCCTTTCAACTAATAACCTTAGTGGTCCAATACCCAGTGAATTATTCAATATTCAAACACTATCAATAATGATCAATGTATCAAAAAATAACTTGGAGGGATCAATACCACAAGAAATAGGGCATCTCAAAAATCTAGTAGAATTTCATGCAGAATCGAATAGATTATCAGGTAAAATCCCTAACACGCTTGGTGATTGCCAGCTCTTACGGTATCTTTATCTGCAAAATAATTTGTTATCTGGTAGCATCCCATCAGCCTTGGGTCAGCTGAAAGGTCTCGAAACTCTTGATCTCTCAAGCAACAATTTGTCAGGCCAGATACCCACATCCTTAGCAGATATTACTATGCTTCATTCCTTGAACCTTTCTTTCAACAGCTTTATGGGGGAAGTGCCAACCATTGGTGCTTTCGCAGATGCATCCGGGATCTCAATCCAAGGCAATGCCAAACTCTGTGGTGGAATACCTGATCTACATCTGCCTCGATGTTGTCCATTACTAGAGAATAGAAAACATTTCCCAGTTCTACCTATTTCTGTTTCTCTGGTCGCAGCACTGGCCATCCTCTCATCACTCTACTTGCTTATAACCTGGCACAAGAGAACTAAAAAGGGAGCCCCTTCAAGAACTTCCATGAAAGGCCACCCATTGGTCTCTTATTCGCAGTTGGTAAAAGCAACAGATGGTTTCGCGCCGACTAATTTGTTGGGTTCTGGATCATTTGGCTCAGTATACAAAGGAAAGCTTAATATCCAAGATCATTTGCAGTGAAGGTACTAAAGCTTGAAAATCCTAAGGCACTCAAGAGT</cdnaseq>

Protein Sequence

<aaseq>DKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLRNLGILVAYENNLSGSIPLAIGNLTELNILLL GTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVE FHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITML HSLNLSFNSFMGEVPTIGAFADASGISIQGNAKLCGGIPDLHLPRCCPLLENRKHFPVLPISVSLVAALA ILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKS</aaseq>

Gene Sequence

{{{DNA}}}

External Link(s)

NCBI Gene:xa21, {{{Link}}}