Difference between revisions of "Os07g0129200"
(→Annotated Information) |
(→Annotated Information) |
||
| Line 14: | Line 14: | ||
OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1) | OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1) | ||
(fig2)[http://ac.els-cdn.com/S098194280101333X/1-s2.0-S098194280101333X-main.pdf?_tid=63c95770-e4c3-11e3-8966-00000aab0f26&acdnat=1401101539_8905c05f1e1ed53663506bdbbcdfa6eb]. | (fig2)[http://ac.els-cdn.com/S098194280101333X/1-s2.0-S098194280101333X-main.pdf?_tid=63c95770-e4c3-11e3-8966-00000aab0f26&acdnat=1401101539_8905c05f1e1ed53663506bdbbcdfa6eb]. | ||
| + | |||
[[File:Expression of OsPR1 influenced.JPG]] | [[File:Expression of OsPR1 influenced.JPG]] | ||
| Line 19: | Line 20: | ||
--[[User:Canghai91|Canghai91]] 19:20, 26 May 2014 (CST)fig1:The expression of OsPR1a and OsPR1b genes influenced by SA, ABA and H2O2 | --[[User:Canghai91|Canghai91]] 19:20, 26 May 2014 (CST)fig1:The expression of OsPR1a and OsPR1b genes influenced by SA, ABA and H2O2 | ||
| + | |||
[[File:Expression of OsPR1 influenced by SA.JPG]] | [[File:Expression of OsPR1 influenced by SA.JPG]] | ||
| Line 27: | Line 29: | ||
===Evolution=== | ===Evolution=== | ||
Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment. | Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment. | ||
| + | |||
[[File:Homologous sequences.JPG]] | [[File:Homologous sequences.JPG]] | ||
| + | |||
fig3:Rice PR1 protein sequence (OsPR1a) with homologous sequences | fig3:Rice PR1 protein sequence (OsPR1a) with homologous sequences | ||
Revision as of 07:29, 29 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Pathogenesis-related proteins(PR) have production/accumulation represents an essential component of the active plant defence repertoire.And they have been used as markers of plant defense responses.The dicot PR1 are recognized as reliable marker genes in defence/stress responses[1].
They are defined as plant proteins that are induced specifically in pathological or related situations.
Activation of OsPR1 genes is an important part of the defence/stress response(s) in rice.
Expression
The responses of individual genes to salicylic acid, jasmonic acid, and ethylene induced defense signaling pathways in rice are likely to be different from those in dicot plants. Transcript levels in healthy leaves, roots, and flowers varied according to each gene[2].
OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1) (fig2)[3].
--Canghai91 19:20, 26 May 2014 (CST)fig1:The expression of OsPR1a and OsPR1b genes influenced by SA, ABA and H2O2
--Canghai91 19:20, 26 May 2014 (CST)fig2:The progress of OsPR1a and OsPR1b genes expression influenced by SA, ABA and H2O2
Evolution
Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment.
fig3:Rice PR1 protein sequence (OsPR1a) with homologous sequences
Labs working on this gene
[1]Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), Kathmandu, GPO Box 8207, Nepal
[2]Department of Agricultural Biology, College of Agriculture and Life Science, Seoul National University
[3]Core Research for Evolutional Science and Technology (CREST), Honcho 4-1-8, Kawaguchi, Saitama 332, Japan
[4]National Institute of Agrobiological Sciences (NIAS), Kannon-dai 2-1-2, Tsukuba, Ibaraki, 305-8602, Japan
References
[1]Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316
[2]Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9
[3]Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165
[4]Ganesh Kumar Agrawala§, Randeep Rakwalb§‡*, Nam-Soo Jwac, Vishwanath Prasad Agrawala.Signalling molecules and blast pathogen attack activates rice OsPR1a and OsPR1b genes: A model illustrating omponents participating during defence/stress response.Plant Physiol. Biochem. 39 (2001) 1095−1103
[5]Ganesh Kumar Agrawal,*,1 Nam-Soo Jwa,† and Randeep Rakwal. A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones,and Protein Phosphatase Inhibitors. Biochemical and Biophysical Research Communications 274, 157–165 (2000)
Structured Information
| Gene Name |
Os07g0129200 |
|---|---|
| Description |
PR1a protein |
| Version |
NM_001065350.1 GI:115470432 GeneID:4342317 |
| Length |
792 bp |
| Definition |
Oryza sativa Japonica Group Os07g0129200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:1544202..1544993 |
| Sequence Coding Region |
1544290..1544796 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:1544202..1544993 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:1544202..1544993 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MASSSSRLSCCLLVLAAAAMAATAQNSAQDFVDPHNAARADVGV GPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIFWGSAGGDWTAASAVSAWV SEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPG NFVGQSPY</aaseq> |
| Gene Sequence |
<dnaseqindica>89..595#tcgatctccatcatctcttcgtctactaacaaagttataatatcaaattaaggtatatatatatatatatagtagctagcttcaattaatggcgagttcgtcgagcaggttatcctgctgcttgctggtgctcgcggcggcggccatggcggcgacggcgcagaactcggcgcaggacttcgtggacccgcacaacgcggcgagggccgacgtcggggtggggccggtgagctgggacgacacggtggcggcgtacgcggagagctacgcggcgcagcggcagggcgactgcaagctggagcactcggactccggcgggaagtacggcgagaacatcttctggggctccgccggcggcgactggacggcggcgagcgccgtgtcggcgtgggtgtcggagaagcagtggtacgaccacggcagcaacagctgctcggcgccggaggggagctcgtgcgggcactacacgcaggtggtgtggcgcgactcgacggcgatcggctgcgcccgcgtcgtctgcgacggcgacctcggcgtcttcatcacctgcaactactcgccgccgggcaacttcgtcggccaatctccctactgattaattaattaattatattatcacactcactaattaatcatatcgtatgctatgctacgtgtttatgcatgtatggacatgtagtgtcatatggtatatcgtatatgtgtacgtataatatacgtacgtatgctggtgagaataaatccgatgaataaataaataaagctgtactgtcagccgtatttgcttagtgt</dnaseqindica> |
| External Link(s) |