Difference between revisions of "Os01g0710200"
m |
m |
||
| Line 1: | Line 1: | ||
| − | + | This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene. | |
==Annotated Information== | ==Annotated Information== | ||
Oryza sativa contains seven genes encoding polyamine oxidases, termed OsPAO1 to OsPAO7 based on their chromosomal number and gene ID number [Fig.1]. | Oryza sativa contains seven genes encoding polyamine oxidases, termed OsPAO1 to OsPAO7 based on their chromosomal number and gene ID number [Fig.1]. | ||
| Line 21: | Line 21: | ||
===Expression=== | ===Expression=== | ||
| − | + | Compared with other PAOs, expression of OsPAO1 appears to be quiet low under physiological conditions, and mainly localizes to the cytoplasm of onion epidermal cells. While expression of OsPAO1 can be markedly induced by spermine (Spm) or T-Spm treatmemt in rice roots, a plausible explanation of this tetraamine-induced OsPAO1 production is that excess amount of tetraamines may be detrimental for root metabolism or growth and thus OsPAO1 is inductively produced to catabolize them immediately. | |
===Evolution=== | ===Evolution=== | ||
| − | + | Phylogenetic analysis of the amino acid sequences of the seven O. sativa PAOs, five Arabidopsis PAOs, and several other plant PAOs have been performed [Fig.2]. Plant PAOs were divided into four clades: clade I includes Arabidopsis AtPAO1, tobacco NtPAO, and apple MdPAO1. Clade II comprises the three rice members, OsPAO2, OsPAO6, and OsPAO7, along with maize ZmPAO, barley HvPAO1, and HvPAO2. Clade III is built by OsPAO1, Brassica juncea BjPAO, and AtPAO5. In clade IV, three rice PAOs, OsPAO3, OsPAO4, and OsPAO5 were grouped together with Arabidopsis peroxisome-localized members, AtPAO2, AtPAO3, and AtPAO4. | |
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Revision as of 08:14, 29 May 2014
This is the Oryza sativa Polyamine oxidase 1(OsPAO1)encoding gene.
Contents
Annotated Information
Oryza sativa contains seven genes encoding polyamine oxidases, termed OsPAO1 to OsPAO7 based on their chromosomal number and gene ID number [Fig.1].
PAOs Genes Accession numbers
OsPAO1 Os01g0710200 NM_001050573
OsPAO2 Os03g0193400 NM_001055782
OsPAO3 Os04g0623300 NM_001060458
OsPAO4 Os04g0671200 NM_001060753
OsPAO5 Os04g0671300 NM_001060754
OsPAO6 Os09g0368200 NM_001069545
OsPAO7 Os09g0368500 NM_001069546
Fig.1
Function
Polyamine oxidases (PAOs) are FAD-dependent enzymes involved in polyamine (PA) catabolism. In plants, the major PAs are the diamine, putrescine (Put), triamine, spermidine (Spd), tetrraamines, spermine (Spm) and thermospermine (T-Spm). These aliphatic amines of small molecular mass are involved in various biological processes, as growth factors, they play important roles in plant development, sex differentiation, fruit ripening, senility and adversity adapting.
In plants, the concentrations of all the PAs are regulated by a dynamic balance between biosynthesis and catabolism. In the latter process, two kinds of enzymes are involved: a copper-dependent diamine oxidase and a flavine adenine dinucleotide (FAD)-dependent polyamine oxidases (PAOs). Recent studies revealed that PAOs are not only active in the terminal catabolism but also in a polyamine back-conversion pathway.
Rice plant appears to contain two types of PAO enzymes: one functioning as a back-conversion enzyme, and the other as a terminal catabolism enzyme. It has been demonstrated that OsPAO1, as well as OsPAO3, OsPAO4 and OsPAO5, can catalyze the back-conversion reactions of some PAs. At different pH, T-Spm, Spm or other PAs can be chosen as the preferred substrate of OsPAO1; both these substrates will be converted to Spd but no further to Put.
Expression
Compared with other PAOs, expression of OsPAO1 appears to be quiet low under physiological conditions, and mainly localizes to the cytoplasm of onion epidermal cells. While expression of OsPAO1 can be markedly induced by spermine (Spm) or T-Spm treatmemt in rice roots, a plausible explanation of this tetraamine-induced OsPAO1 production is that excess amount of tetraamines may be detrimental for root metabolism or growth and thus OsPAO1 is inductively produced to catabolize them immediately.
Evolution
Phylogenetic analysis of the amino acid sequences of the seven O. sativa PAOs, five Arabidopsis PAOs, and several other plant PAOs have been performed [Fig.2]. Plant PAOs were divided into four clades: clade I includes Arabidopsis AtPAO1, tobacco NtPAO, and apple MdPAO1. Clade II comprises the three rice members, OsPAO2, OsPAO6, and OsPAO7, along with maize ZmPAO, barley HvPAO1, and HvPAO2. Clade III is built by OsPAO1, Brassica juncea BjPAO, and AtPAO5. In clade IV, three rice PAOs, OsPAO3, OsPAO4, and OsPAO5 were grouped together with Arabidopsis peroxisome-localized members, AtPAO2, AtPAO3, and AtPAO4.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0710200 |
|---|---|
| Description |
Amine oxidase domain containing protein |
| Version |
NM_001050573.1 GI:115439516 GeneID:4327828 |
| Length |
1539 bp |
| Definition |
Oryza sativa Japonica Group Os01g0710200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:31269225..31270763 |
| Sequence Coding Region |
31269225..31270763 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:31269225..31270763 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:31269225..31270763 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MVAKKPRVVVVGAGISGLAAAHRLCGAGGDRFEVAVVEAGDRVG GRILTSEFAGHRVEMGATWVQGVVGSPVYALARDAGALGEEEGRGLPYERMDGFPDRV LTVAEGGEVVDADTVAGPIEELYRGMMEAARAGEAGGGGGVEEYLRRGLRAYQAARSA GGGGGGGKELEEVDEALLAMHINRERTDTSADDLGDLDLTAEGEYRDFPGEHVTIPGG YSRVVERLAAALPPGTVRLGLRLRRLKWGGTPVRLHFADGAPPLTADHVILTVSLGVL KASLGNKDTAGVGAAAIAFDPPLPPFKREAVARLGFGVVNKLFMEVEAVAPSEPEDVA GVQPAAAGFPFLHMAFRGHVSKIPWWMRGTESICPVHAGSTVALAWFAGREAAHLESL PDDDVIRGAHATLDSFLPAAPRWRVRRIKRSGWATDPLFLGSYSYVAVGSSGDDLDRM AEPLPRGPDAAADERPPSPRLLFAGEATHRTHYSTTHAAYLSGVREANRLLQHYRGGA NHTT</aaseq> |
| Gene Sequence |
<dnaseqindica>1..1539#atggtggcgaagaagccgagggttgtggtggtgggcgcggggatatcgggcctcgcggcggcgcaccggctgtgcggcgcgggcggggacaggttcgaggtggcggtggtggaggccggcgaccgagtcggcggccggatcctcacgtccgagttcgccggccaccgggtcgagatgggcgccacgtgggtgcagggcgtcgtcgggagccccgtgtacgctctggcgcgcgacgccggcgcgctcggggaggaggagggtcgtggtctcccgtacgagcgcatggacggcttccccgaccgcgtgctgaccgtcgcagagggcggcgaggtcgtcgacgcggacacggtggctggcccgatcgaggagctgtacaggggcatgatggaggccgcgcgcgccggcgaggctggtggtggaggcggcgtggaggagtacctgcgccgtggcctacgggcgtaccaggcggcgcggtctgccggcggcggcggcggcggcggcaaggagcttgaggaggtggacgaggcgctgctcgccatgcacatcaaccgggagcggaccgacacctccgccgacgacctcggcgacctcgacctcaccgccgagggcgagtaccgcgacttccccggcgaacacgtcacgattcccggcggctactcccgcgtggtcgagcgcctcgccgctgcgctcccgcccggcaccgtccgcctcggactccgtctccgccgtctcaagtggggcggaacccctgtccgcctccacttcgcggatggcgcgccgccgctcaccgccgaccacgtcatcctcacggtctcgctgggcgtcctcaaggccagcctcggcaacaaggacaccgccggcgttggcgcggccgccatcgccttcgacccgccgctcccgcctttcaagcgcgaggccgtcgcgcgcctcggcttcggcgtcgtgaacaagctgttcatggaggtggaggccgtggcgccatcggaaccggaggacgtcgccggcgtgcagccggcggcggcgggcttcccgttcctgcacatggcgttccggggacacgtgtccaagatcccgtggtggatgcgcggcacggagtcgatctgccccgtccacgcgggctccaccgtggcgctggcgtggttcgccggccgggaggcggcgcacctcgagtccctccccgacgacgacgtcatccgcggggcccacgccacgctggactccttcctcccggcggcgccacggtggagggtgaggaggatcaagcggagcgggtgggccacggacccgctcttcctcgggtcatacagctacgtggccgtcggatcgagcggcgacgacctcgatcgcatggccgaaccgctgccacgtgggccagacgccgccgccgacgagcggccgccgtcgccgcggctgctgttcgccggcgaggcgacgcaccgcacgcactactcaacgacgcacgccgcgtacctgagcggcgtgcgcgaggctaaccggctgctgcaacactaccgcggcggagcgaatcacaccacgtag</dnaseqindica> |
| External Link(s) |