Difference between revisions of "Os04g0475600"
(→Function) |
|||
| Line 7: | Line 7: | ||
===Function=== | ===Function=== | ||
| + | This gene named dioxygenase for auxin oxidation gene or 2-oxoglutarate-dependent-Fe (II) dioxygenase.Its gene symbol is DAO.This gene code 2-oxoglutarate-dependent-Fe (II) dioxygenase which is essential for anther dehiscence, pollen fertility, and seed initiation in rice.In vitro recombination,the gene DAO make active IAA into no biological activity of 2 - indole 3 acetic oxide. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries | ||
===Highlight=== | ===Highlight=== | ||
Revision as of 14:58, 29 May 2014
This gene named dioxygenase for auxin oxidation gene or 2-oxoglutarate-dependent-Fe (II) dioxygenase.Its gene symbol is DAO.This gene code 2-oxoglutarate-dependent-Fe (II) dioxygenase which is essential for anther dehiscence, pollen fertility, and seed initiation in rice.In vitro recombination,the gene DAO make active IAA into no biological activity of 2 - indole 3 acetic oxide. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries.
Contents
Expression
The identification of the rice dioxygenase for auxin oxidation (DAO) gene, which encodes a 2-oxoglutarate-dependent-Fe (II) (2OGFe (II))dioxygenase responsible for catalyzing the irreversible oxidation of IAA to OxIAA and essential for plant reproductive development.Sequence and phylogenetic analysis showed that DAO is a single copy gene in rice that is predicted to encode a 2OG-Fe(II) dioxygenase with a dioxygenase domain that is conserved in several classes of dioxygenase, including the GA-2 oxidase(GA2ox), GA-3 oxidase (GA3ox), and GA-20 oxidase (GA20ox).
Function
This gene named dioxygenase for auxin oxidation gene or 2-oxoglutarate-dependent-Fe (II) dioxygenase.Its gene symbol is DAO.This gene code 2-oxoglutarate-dependent-Fe (II) dioxygenase which is essential for anther dehiscence, pollen fertility, and seed initiation in rice.In vitro recombination,the gene DAO make active IAA into no biological activity of 2 - indole 3 acetic oxide. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries
Highlight
•Rice dao mutants contain increased levels of free IAA in anthers and ovaries
•dao mutants are defective in anther dehiscence, pollen grains, and seed development
•DAO encodes a 2-oxoglutarate-dependent-Fe (II) dioxygenase
•DAO catalyzes the conversion of active IAA into biologically inactive OxIAA
Evolution
Indole-3-acetic acid (IAA), the natural auxin in plants, regulates many aspects of plant growth and development. Extensive analyses have elucidated the components of auxin biosynthesis, transport, and signaling, but the physiological roles and molecular mechanisms of auxin degradation remain elusive. Here, we demonstrate that the dioxygenase for auxin oxidation (DAO) gene, encoding a putative 2-oxoglutarate-dependent-Fe (II) dioxygenase, is essential for anther dehiscence, pollen fertility, and seed initiation in rice. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries. Furthermore, exogenous application of IAA or overexpression of the auxin biosynthesis gene OsYUCCA1 phenocopies the dao mutants. We show that recombinant DAO converts the active IAA into biologically inactive 2-oxoindole-3-acetic acid (OxIAA) in vitro. Collectively, these data support a key role of DAO in auxin catabolism and maintenance of auxin homeostasis central to plant reproductive development.
This gene is belong to oryza sativa and it is one of the world's oldest crop specise.In a heavy huge scale study,US researchers have thought oryza sativa orginated in China.As soon as 800 years ago appear in the Yangtze basin China.This gene is on the fourth chromsome in the rice.
Labs working on this gene
Shenyang Institute of Aeronautical Engineering, Feng-t’ien, Liaoning, China
Climate Stress Laboratory Janet P. Slovin
Horticultural Crops Quality Laboratory Jerry D. Cohen
United States Department of Agriculture, Beltsville, Maryland
References
[1]Spielmeyer, W., Ellis, M.H., and Chandler, P.M. (2002). Semidwarf (sd-1),‘‘green revolution’’ rice, contains a defective gibberellin 20-oxidase gene.Proc. Natl. Acad. Sci. USA 99, 9043–9048.
[2]Normanly, J., Slovin, J.P., and Cohen, J.D. (1995). Rethinking auxin biosynthesis and metabolism. Plant Physiol. 107, 323–329.
[3]Zhigang Zhao, Yunhui Zhang, Xi Liu.ect(2013). A Role for a Dioxygenase in Auxin Metabolism and Reproductive Development in Rice. Developmental Cell. 14 October 2013, 113–122.
Structured Information
| Gene Name |
Os04g0475600 |
|---|---|
| Description |
2OG-Fe(II) oxygenase domain containing protein |
| Version |
NM_001059610.1 GI:115458949 GeneID:4336150 |
| Length |
1939 bp |
| Definition |
Oryza sativa Japonica Group Os04g0475600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:24194135..24196073 |
| Sequence Coding Region |
24194432..24194674,24194894..24195212,24195312..24195652 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:24194135..24196073 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:24194135..24196073 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtggagatcccggcgatcgacctgcggctggccggcggcggcggcggcgcggaggagacggcgaggctgcgcgacgcgtgcgcgcggctgggctgcttccgggtgtcggggcacggcgtgccgccggggctccaggccgagatgaaggccgcggtgcgcgcgctcttcgacctccccgacgacgccaagcgccgcaacgccgacatcatcccgggcagcggctacgtcccgcccggcacagccaacccgctctacgaggccttcggcctctgcgacgccgccgcccccgccgacgtcgacgccttctgcgcccgcctcgacgcgccgccccacgtcagggagaccgtgaaggcgtacgccgagaggatgcactcgctgatcgtggacgtcgccggcaaggtcgccgcgagcctggggctgcacggcgcctcgttccaggactggccgtgccagttccgcatgaacaggtacaactacacgcaggactccgtgggctcccccggcgtgcaggtccacacggactccggcttcctcaccgtgctccaggaggacgagtgcgttggcgggctcgaggtgctcgaccccgccgccggcgagttcgtccccgtcgaccccctccccggctcgttcgtcgtcaacgtcggcgacgtcggccaggcgtggagcaacgggaggctgcacaacgtgaagcacagggtgcagtgcgtggcggcggtgccgcgcgtgtcgatcgccatgttcctgctggcgcccaaggacgacacggtgagcgcgccgggggagctggtggacggcgagcacccgcgccggtacagggagttcaagtacgacgactaccggaggctccggctgtccaccggcgagcgcgccggcgaggcgctcgcgcgtctggcggcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MVEIPAIDLRLAGGGGGAEETARLRDACARLGCFRVSGHGVPPG LQAEMKAAVRALFDLPDDAKRRNADIIPGSGYVPPGTANPLYEAFGLCDAAAPADVDA FCARLDAPPHVRETVKAYAERMHSLIVDVAGKVAASLGLHGASFQDWPCQFRMNRYNY TQDSVGSPGVQVHTDSGFLTVLQEDECVGGLEVLDPAAGEFVPVDPLPGSFVVNVGDV GQAWSNGRLHNVKHRVQCVAAVPRVSIAMFLLAPKDDTVSAPGELVDGEHPRRYREFK YDDYRRLRLSTGERAGEALARLAA</aaseq> |
| Gene Sequence |
<dnaseqindica>1400..1642#862..1180#422..762#agaagcaaacactgcgatcatccgaagcaatctcaatctcacctgtccatatcgcgcacgaattcgtaaagtgcaagctagaaacatgtgtcacatgtcgtgctgatcgttcgatccaccacggtgcgagcggtgagtgtcgtgacgaagcaaaggcagaggcagcagcgggaaacggcgcccccccgtgtgtcgatcggctgtctcgccgaacagggcaaatacgccaacaaaaaacggcctcgttttcccttgctcgcacgcaccgtgtcgctcccaggcgacaagccgtggcgcgactcgccgcccccctgcgccccctcgcccccgcgcgtcgctttcacgtcgcacctctaaataccaccaccccggactcggcggcgagcccccgcgccaagaacgaaaggcgagagtgagagagatggtggagatcccggcgatcgacctgcggctggccggcggcggcggcggcgcggaggagacggcgaggctgcgcgacgcgtgcgcgcggctgggctgcttccgggtgtcggggcacggcgtgccgccggggctccaggccgagatgaaggccgcggtgcgcgcgctcttcgacctccccgacgacgccaagcgccgcaacgccgacatcatcccgggcagcggctacgtcccgcccggcacagccaacccgctctacgaggccttcggcctctgcgacgccgccgcccccgccgacgtcgacgccttctgcgcccgcctcgacgcgccgccccacgtcaggtgaccatttactgatcttgcaccgccccccaatcccaattggaattgcgattttggtctcaagaaacggatgaattaatccgggcccggatgaagcagggagaccgtgaaggcgtacgccgagaggatgcactcgctgatcgtggacgtcgccggcaaggtcgccgcgagcctggggctgcacggcgcctcgttccaggactggccgtgccagttccgcatgaacaggtacaactacacgcaggactccgtgggctcccccggcgtgcaggtccacacggactccggcttcctcaccgtgctccaggaggacgagtgcgttggcgggctcgaggtgctcgaccccgccgccggcgagttcgtccccgtcgaccccctccccggctcgttcgtcgtcaacgtcggcgacgtcggccaggttcacaaacatatcatcaaaatatattcaatttaattactaaaattaataagatatatccctccgtcggtgctgtaggtgttgttatttttctataaatttgattcaacctaaaaatattaagaaaatatcaaacgacttataattcgagacgaagggagtaactactattccatttttcgcgggaatttctcaccgaatctcggtgtgttgtctcaggcgtggagcaacgggaggctgcacaacgtgaagcacagggtgcagtgcgtggcggcggtgccgcgcgtgtcgatcgccatgttcctgctggcgcccaaggacgacacggtgagcgcgccgggggagctggtggacggcgagcacccgcgccggtacagggagttcaagtacgacgactaccggaggctccggctgtccaccggcgagcgcgccggcgaggcgctcgcgcgtctggcggcctgacacctggccacggtccattgtcgcgaccgtttattacgcggagtgctcactgctgactagaatgtccattaggcctccctgtatggccgtgtcgattctgaacaataaaatcttcgacgtacgacagtgaaaaaaatttgtaaaggatgctgaggggatgggaattttaggggttaataagtcttttgtttggctggaggagatgatgagttgtaggaataactggaaggtggagtttgtgagtaaattcccacctttttaatatagaggactataattgggaggaaagtccctttc</dnaseqindica> |
| External Link(s) |