Difference between revisions of "Os11g0117400"
Jiayouyixia (talk | contribs) (→Function) |
Jiayouyixia (talk | contribs) (→Expression) |
||
| Line 18: | Line 18: | ||
led to growth retardation at the early stage and reduction of intern ode length. Scanni ng elect ron microscopy reve aled | led to growth retardation at the early stage and reduction of intern ode length. Scanni ng elect ron microscopy reve aled | ||
an increas e in wax deposi tion on leaf surface s of the OsWR KY89 overexpre ssion lines and a decr ease in wax loading in the RNAi-me diated OsW RKY89 suppr ession lines. More over, extractabl e and cell-wa ll-bound phenol ic compo unds were decr eased in the overe xpressor lines, but its SA leve ls were increas ed. Ligni n staining showed an increas e in lignific ation in culms of the overe xpressor lines. Intere stingly, overexpre ssion of the OsWRKY89 gene enhanc ed resistanc e to the rice blast fungus and white-backe d planthop per as well as tolerance to UV-B irradia-tion. Th ese resu lts sugges t that OsW RKY89 plays an important rol e in resp onse to biotic and abiotic stresses<ref name="ref1" />. | an increas e in wax deposi tion on leaf surface s of the OsWR KY89 overexpre ssion lines and a decr ease in wax loading in the RNAi-me diated OsW RKY89 suppr ession lines. More over, extractabl e and cell-wa ll-bound phenol ic compo unds were decr eased in the overe xpressor lines, but its SA leve ls were increas ed. Ligni n staining showed an increas e in lignific ation in culms of the overe xpressor lines. Intere stingly, overexpre ssion of the OsWRKY89 gene enhanc ed resistanc e to the rice blast fungus and white-backe d planthop per as well as tolerance to UV-B irradia-tion. Th ese resu lts sugges t that OsW RKY89 plays an important rol e in resp onse to biotic and abiotic stresses<ref name="ref1" />. | ||
| + | |||
| + | [[File:图片1.png]] | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 02:56, 30 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
WRKY genes are a family of transcriptional regulatory factors that have specific functions in plants.Plant WRKY gene-encoded transcriptional regulators appear to be involved in various physiological programs, including disease-resistance,senescence,stress responses of biotic and abiotic, growth and development processes[1].
Expression
Please input expression information here.
Expression of OsW89p::GUS was observed in leaves, stems, and sheaths; pollens hadn't expression; mature seeds hadn't expression; the embryos of germinating seeds had expression; primary roots, adventitious roots and their lateral roots had expression but not in root tips of seedling stage; only lateral roots had expressin in roots of maturation phase[1].
Analyzing inducible expression pattern in T1 transgenic seedlings, the results showed: expression level of OsW89p::GUS can be increased by MeJA, IAA, ultraviolet, high temperature, low temperature and wounding treatment, inducible effects of MeJA and ultraviolet were distinct; and can be restrined by 2, 4-D; ABA and SA can't influence OsW89p::GUS expession; NaCl and PEG can restrain expression level of OsW89p::GUS in roots but increase expression level in leaves.GUS activity of OsW89p::GUS was higher than 35s::GUS in trangenic plants.In conclusion,we thought OsWRKY89 gene promoter was an inducible promoter with tissue specific expression characteristic[1].
RNA gel blot analysi s indicated thatOsWRK Y89was strongl y induc ed by treatme nts of methyl jasmon ate and UV-B radiation . The transient expressi on analysis of the OsW RKY89–eG FP reporte r in onion epid ermal cel ls reve aled that OsWR KY89 was targeted to nuclei. Trans criptiona l activity assays of OsWR KY89 and its mutant s fused with a GA L4 DNA binding domain indicated that the 67 C-termina l amino acids were require d for the transcrip tional activation and that the leucine zipp er region at the N-term inus enhanc ed its tra nscriptio nal activit y. Ove rexpression of OsWRK Y89 led to growth retardation at the early stage and reduction of intern ode length. Scanni ng elect ron microscopy reve aled an increas e in wax deposi tion on leaf surface s of the OsWR KY89 overexpre ssion lines and a decr ease in wax loading in the RNAi-me diated OsW RKY89 suppr ession lines. More over, extractabl e and cell-wa ll-bound phenol ic compo unds were decr eased in the overe xpressor lines, but its SA leve ls were increas ed. Ligni n staining showed an increas e in lignific ation in culms of the overe xpressor lines. Intere stingly, overexpre ssion of the OsWRKY89 gene enhanc ed resistanc e to the rice blast fungus and white-backe d planthop per as well as tolerance to UV-B irradia-tion. Th ese resu lts sugges t that OsW RKY89 plays an important rol e in resp onse to biotic and abiotic stresses[2].
Evolution
Please input evolution information here.
Knowledge Extension
Please input evolution information here.
You can also add sub-section(s) at will.
WRKY genes encode transcription factors that are involved in the regulation of various biological processes. These zinc-finger proteins, especially those members mediating stress responses, are uniquely expanded in plants[3].
The WRKY gene family, important for plant development and responses to both biotic and abiotic stresses, has encoun-tered several duplication and deletion events in very recent evolutionary history in Oryza sativa. Completing the annotation of this family in rice will enable the determination of whether these changes are simply neutral occurrences in a heavily redundant family of transcription factors or whether they ac-tively contributed to the variation between modern rice sub-species and cultivars. Mounting evidence indicates that WRKY genes modulate the signaling networks for all hormones and regulate the biosynthesis of starch, sesquiterpene, and alka-loids in a variety of plants, including important crops. There is no doubt that studies of this family of transcription factors will not only further our understanding of the fundamental pro-cesses that are controlled by WRKY genes, but also help en-hance agricultural productivity[3].
Labs working on this gene
Please input related labs here.
Department of Plant Pathology, State Key Laboratory of Agrobiotechnology, China Agricultural University, Yuanmenyuan West Rd. 2, Beijing 100094, China
Biotechnology Institute, Zhejiang University, Hangzhou 310029, China
Department of Biological Sciences, Hunan University of Science and Technology, Xiangtan 411201, China
Institute of Insect Sciences, Zhejiang University, Hangzhou 310029, China
Bioinformatics Core, School of Life Sciences, University of Nevada, Las Vegas, Nevada 89154, USA
College of Agriculture and Biotechnology Zhejiang University, Hangzhou, P. R. China May. 2005
References
- ↑ 1.0 1.1 1.2 郝中娜 (2005). 水稻 WRKY19 和 WRKY89 基因启动子的分析, 浙江大学.
- ↑ Haihua Wang;Junjie Hao;Xujun Chen;Zhongna Hao;Xia Wang;Yonggen Lou;Youliang Peng;Zejian Guo Overexpression of rice WRKY89 enhances ultraviolet B tolerance and disease resistance in rice plants Plant Molecular Biology, 2007, 65(6): 799-815.
- ↑ 3.0 3.1 Christian A. Ross;Yue Liu;Qingxi J. Shen The WRKY Gene Family in Rice (Oryza sativa) Journal of Integrative Plant Biology, 2007, 49(6): 827-842.
Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Structured Information
| Gene Name |
Os11g0117400 |
|---|---|
| Description |
DNA-binding WRKY domain containing protein |
| Version |
NM_001072123.2 GI:297611109 GeneID:4349611 |
| Length |
1015 bp |
| Definition |
Oryza sativa Japonica Group Os11g0117400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:781474..782488 |
| Sequence Coding Region |
781474..781891,781997..782104,782198..782463 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:781474..782488 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:781474..782488 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatagagcaccaaaaggctctcatggtggagctgcgtggcatggtcatgccattacttccgagcgacaatgaacaagccaagcttgctcttcaactcttgggagatatattgagttgctcagataaggctatctccatgctagaacttggtggagacactaaaaagctgaccaatcttgttggaggtaagagaaaaggtgacaagcatagcatggacaaccacaacttggaggaggaagccaaagaaagtgttagcaagagaagaaagaatgcagaacacacaggttcaactgtggctcaagcacctcacaatgatggacatcaatggaggaagtatggtcagaaatggatctctagagcaaaacattccaggagctactataggtgtgccaatagtaaagtgcaaggctgtcctgctacaaagacagtgcaacaaatggattccagtggaaatggaacatcaaagttgttcaacgttgactactatggccaacacacatgcaggggagatggcatagccgatccatatgttgtcgacacagcccatcacagtatggaacctatcaatcaaaacgaatgcaatagccctacacttgaacacgaagcccatgaagttcaagatgaaagatttgaaaacttgtgtatggtacaaaatatgccagagtatttgatagattttgaattggagagagccttcgagtttattgtgaactcaccattgggttctgagcattggacgttcgatgattcaataagatgtgagcacagtccaatatgcatatggggatga</cdnaseq> |
| Protein Sequence |
<aaseq>MIEHQKALMVELRGMVMPLLPSDNEQAKLALQLLGDILSCSDKA ISMLELGGDTKKLTNLVGGKRKGDKHSMDNHNLEEEAKESVSKRRKNAEHTGSTVAQA PHNDGHQWRKYGQKWISRAKHSRSYYRCANSKVQGCPATKTVQQMDSSGNGTSKLFNV DYYGQHTCRGDGIADPYVVDTAHHSMEPINQNECNSPTLEHEAHEVQDERFENLCMVQ NMPEYLIDFELERAFEFIVNSPLGSEHWTFDDSIRCEHSPICIWG</aaseq> |
| Gene Sequence |
<dnaseqindica>598..1015#385..492#26..291#tagtgactgtcaagtagtgatcaacatgatagagcaccaaaaggctctcatggtggagctgcgtggcatggtcatgccattacttccgagcgacaatgaacaagccaagcttgctcttcaactcttgggagatatattgagttgctcagataaggctatctccatgctagaacttggtggagacactaaaaagctgaccaatcttgttggaggtaagagaaaaggtgacaagcatagcatggacaaccacaacttggaggaggaagccaaagaaagtgttagcaagagaaggtatatgtatataaatacatgccactagaggaatgtccactagcttatcattcattgctaacgaaatttgattgatcctcttgattatgatagaaagaatgcagaacacacaggttcaactgtggctcaagcacctcacaatgatggacatcaatggaggaagtatggtcagaaatggatctctagagcaaaacattccaggtataaatgagcatatgaactcctgtttatttccattcctcgaagcatattggttttatctaacagcaaaatatatacatctaatgagctcatttgcttaagcaggagctactataggtgtgccaatagtaaagtgcaaggctgtcctgctacaaagacagtgcaacaaatggattccagtggaaatggaacatcaaagttgttcaacgttgactactatggccaacacacatgcaggggagatggcatagccgatccatatgttgtcgacacagcccatcacagtatggaacctatcaatcaaaacgaatgcaatagccctacacttgaacacgaagcccatgaagttcaagatgaaagatttgaaaacttgtgtatggtacaaaatatgccagagtatttgatagattttgaattggagagagccttcgagtttattgtgaactcaccattgggttctgagcattggacgttcgatgattcaataagatgtgagcacagtccaatatgcatatggggatga</dnaseqindica> |
| External Link(s) |
