Difference between revisions of "Os10g0478000"
Chenyaping (talk | contribs) (→Function) |
Chenyaping (talk | contribs) (→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | [[File:YoshidaF1.jpg|right|thumb|200px|Fig 1. Characterization of ''taw1'' dominant mutants <ref name="ref1" />.]] [[File:YoshidaF2.jpg|right|thumb| | + | [[File:YoshidaF1.jpg|right|thumb|200px|Fig 1. Characterization of ''taw1'' dominant mutants <ref name="ref1" />.]] [[File:YoshidaF2.jpg|right|thumb|250px|Fig 2. Isolation of the ''TAW1'' gene <ref name="ref1" />.]] [[File:YoshidaF3.jpg|right|thumb|250px|Fig 3. Expression pattern of ''TAW1'' <ref name="ref1" />.]] [[File:YoshidaF4.jpg|right|thumb|250px|Fig 4. ''SVP'' subfamily MADS-box genes work downstream of ''TAW1'' <ref name="ref1" />.]] [[File:YoshidaF5.jpg|right|thumb|250px|Fig 5. Phenotype of ''taw1-D2''–introgressed Koshihikari BC5F2 plants <ref name="ref1" />.]] |
In the dominant gain-of-function mutant ''tawawa1-D'', the activity of the inflorescence meristem (IM) is extended and spikelet specification is delayed, resulting in prolonged branch formation and increased numbers of spikelets. In contrast, reductions in ''TAWAWA1'' (''TAW1'') activity cause precocious IM abortion and spikelet formation, resulting in the generation of small inflorescences. ''TAW1'' encodes a nuclear protein of unknown function and shows high levels of expression in the shoot apical meristem, the IM, and the branch meristem (BMs). ''TAW1'' expression disappears from incipient spikelet meristems (SMs). It is demonstrated that members of the ''SHORT VEGETATIVE PHASE'' subfamily of MADS-box genes function downstream of ''TAW1''.Thus, ''TAW1'' is proposed as a unique regulator of meristem activity in rice and regulates inflorescence development through the promotion of IM activity and suppression of the phase change to SM identity <ref name="ref1" />. | In the dominant gain-of-function mutant ''tawawa1-D'', the activity of the inflorescence meristem (IM) is extended and spikelet specification is delayed, resulting in prolonged branch formation and increased numbers of spikelets. In contrast, reductions in ''TAWAWA1'' (''TAW1'') activity cause precocious IM abortion and spikelet formation, resulting in the generation of small inflorescences. ''TAW1'' encodes a nuclear protein of unknown function and shows high levels of expression in the shoot apical meristem, the IM, and the branch meristem (BMs). ''TAW1'' expression disappears from incipient spikelet meristems (SMs). It is demonstrated that members of the ''SHORT VEGETATIVE PHASE'' subfamily of MADS-box genes function downstream of ''TAW1''.Thus, ''TAW1'' is proposed as a unique regulator of meristem activity in rice and regulates inflorescence development through the promotion of IM activity and suppression of the phase change to SM identity <ref name="ref1" />. | ||
Revision as of 04:18, 30 May 2014
The rice TAWAWA1 (TAW1) gene, a member of ALOG family, was identified as a regulator of rice inflorescence architecture.
Contents
Annotated Information
Function
In the dominant gain-of-function mutant tawawa1-D, the activity of the inflorescence meristem (IM) is extended and spikelet specification is delayed, resulting in prolonged branch formation and increased numbers of spikelets. In contrast, reductions in TAWAWA1 (TAW1) activity cause precocious IM abortion and spikelet formation, resulting in the generation of small inflorescences. TAW1 encodes a nuclear protein of unknown function and shows high levels of expression in the shoot apical meristem, the IM, and the branch meristem (BMs). TAW1 expression disappears from incipient spikelet meristems (SMs). It is demonstrated that members of the SHORT VEGETATIVE PHASE subfamily of MADS-box genes function downstream of TAW1.Thus, TAW1 is proposed as a unique regulator of meristem activity in rice and regulates inflorescence development through the promotion of IM activity and suppression of the phase change to SM identity [1].
Expression
Please input expression information here.
Evolution
TAW1 function might have evolved to ensure the production of sufficient numbers of spikelets. Unraveling the molecular function of TAW1 will provide an opportunity for a greater understanding of meristem activity and identity, which is a fundamental issue in plant biology. Furthermore, such knowledge could be exploited to further increase crop yields. In addition, TAW1 is of great interest with respect to the evolution of inflorescence architecture. TAW1 function may be essential for the development of compound inflorescences, in which the branching pattern is crucial [1].
Labs working on this gene
- Graduate School of Agriculture and Life Sciences, The University of Tokyo, Yayoi, Bunkyo, Tokyo 113-8657, Japan
References
<references> [1]
Structured Information
| Gene Name |
Os10g0478000 |
|---|---|
| Description |
Protein of unknown function DUF640 domain containing protein |
| Version |
NM_001189280.1 GI:297727690 GeneID:9266624 |
| Length |
1426 bp |
| Definition |
Oryza sativa Japonica Group Os10g0478000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:18345508..18346933 |
| Sequence Coding Region |
18345710..18346324 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:18345508..18346933 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:18345508..18346933 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagttcgtggcgcacgcggcggcgccggacagcccgcactcggacagcggcggaggaggagggggaatggcgacgggggcgacgtcggcgtcggcggcgggggcgtcgccgagcaggtacgagtcgcagaagcggcgggactggaacacgttcgggcagtacctccgcaaccaccggccgccgctgtcgctggcgcggtgcagcggcgcgcacgtcctggagttcctccgctacctggaccagttcggcaagaccaaggtgcacgcgccggcgtgccccttcttcggccacccggcgccgccggcgccgtgcccgtgcccgcttcgccaggcgtggggcagcctcgacgccctcgtcggccgcctccgcgccgcctacgaggagaacggcggccgccccgagaacaaccccttcggcgcccgcgccgtccgcctctacctccgcgaggtccgcgagcaccaggcgcgcgcacgcggcgtcagctacgagaagaagaagcgcaagaagccaccccacccctcctccgccgccgccgcgcacgacgacgccgccaacggcgccctccaccaccaccaccacatgccgccgcctcctcccggcgccgccgcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MEFVAHAAAPDSPHSDSGGGGGGMATGATSASAAGASPSRYESQ KRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHAPACPFFGHPAPP APCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVREHQARARG VSYEKKKRKKPPHPSSAAAAHDDAANGALHHHHHMPPPPPGAAA</aaseq> |
| Gene Sequence |
<dnaseqindica>610..1224#tatcggctccttctcgcccagcttttgctcacgtcacatcaccttccacctccacccctccactcgctcgctcgcttgcttgctccaattaatacctcttctccttctcccccagcaactagcttccttctccgcttttgcagctcgccgccgccgccgccgccgccgccgcgacacggcgcgcatatggtcgtcgtcgtcgtcgtcgtcgtcgctggagaagacgaagaaagatagtagacctgagctgggggggcggtgaattcgccggagagctagctaaggtgagtttcgttttcggtttcggtttcgatcgatttgttggtgcagatgcatctgggagctagagaactatttatagtggctgcggtgcggtgcggcgtcgccacgccgcgcacgcgctcgcccacgtcgcgcgcgcgcgggcgcgcgtccactctctctctctcttggaccactgcgcgcgcgggcgcgcgtcggcgtcgccacggcttctcaagaacgcgcgcgcgcgcactgattcccagatagatagatctatatctgttcgtcttcctcagctatggtgtggtggtggtggtggtgtttgtggtgttgtgcagatcgacgatggagttcgtggcgcacgcggcggcgccggacagcccgcactcggacagcggcggaggaggagggggaatggcgacgggggcgacgtcggcgtcggcggcgggggcgtcgccgagcaggtacgagtcgcagaagcggcgggactggaacacgttcgggcagtacctccgcaaccaccggccgccgctgtcgctggcgcggtgcagcggcgcgcacgtcctggagttcctccgctacctggaccagttcggcaagaccaaggtgcacgcgccggcgtgccccttcttcggccacccggcgccgccggcgccgtgcccgtgcccgcttcgccaggcgtggggcagcctcgacgccctcgtcggccgcctccgcgccgcctacgaggagaacggcggccgccccgagaacaaccccttcggcgcccgcgccgtccgcctctacctccgcgaggtccgcgagcaccaggcgcgcgcacgcggcgtcagctacgagaagaagaagcgcaagaagccaccccacccctcctccgccgccgccgcgcacgacgacgccgccaacggcgccctccaccaccaccaccacatgccgccgcctcctcccggcgccgccgcctgagccgagccgagcttgctccaagatcgccggaaaacgagctgctagcctcctacgcatgcactagttactccactccactccactccactatgatccctagctaggctgctcttgctactagcaaaactacggattaatctccatgcttgctactgctgctgctgctgctactgcatctaattaattaggttgattatttcct</dnaseqindica> |
| External Link(s) |