Difference between revisions of "Os07g0512200"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 10: Line 10:
  
 
===Expression===
 
===Expression===
Please input expression information here
+
 
  
 
OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]
 
OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]

Revision as of 14:24, 30 May 2014

Please input one-sentence summary here.

Annotated Information

Function

An essential protein in the yeast or Arabidopsis autophagic pathway is Atg8. OsAtg8 conjugation pathway may be conserved in rice and may play important roles in rice autophagy.[1]

Autophagy occurs at low basal levels in virtually all cells to perform homeostatic functions such as protein and organelle turnover. It is rapidly upregulated when cells need to generate intracellular nutrients and energy, for example, during starvation or high bioenergetic demands. Autophagy is also upregulated when cells are preparing to undergo structural remodeling such as during developmental transitions or to rid themselves of damaging cytoplasmic components, for example, during oxidative stress, infection, or protein aggregate accumulation. Nutritional status, hormonal factors, and other cues like temperature, oxygen concentrations, and cell density are important in the control of autophagy. [2]

Expression

OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0512200

Description

Similar to Symbiosis-related like protein

Version

NM_001066302.1 GI:115472336 GeneID:4343365

Length

2701 bp

Definition

Oryza sativa Japonica Group Os07g0512200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:20285683..20288383

Sequence Coding Region

20286147..20286241,20286327..20286445,20286846..20286898,20286988..20287043,20288034..20288070

Expression

GEO Profiles:Os07g0512200

Genome Context

<gbrowseImage1> name=NC_008400:20285683..20288383 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:20285683..20288383 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccaggacttccttcaagctcgagcacccactggaaaggaggcaagcagaatctgccaggatccgtgagaagtactcagacagaattccggtgatcgttgagaaggctgacaagaccgatgttccagaaattgacaaaaagaagtaccttgtccctgctgatcttactgttggccagtttgtctatgtggttcggaagaggattaagcttagcccagaaaaggccatctttgtctttgtgaagaacacattgccgccaactgcttctttgatgtctgcaatctacgaagagaacaaggatgaggacggcttcctctacatgacttacagtggcgagaacacattcggctctgcgtaa</cdnaseq>

Protein Sequence

<aaseq>MARTSFKLEHPLERRQAESARIREKYSDRIPVIVEKADKTDVPE IDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDE DGFLYMTYSGENTFGSA</aaseq>

Gene Sequence

<dnaseqindica>2143..2237#1939..2057#1486..1538#1341..1396#314..350#aaaccctaccgcgacttccttccttccttccggttgcttccgccgatcgacttctcgccccccaaatcgattcgccccccgcctcgatctatcgattccgcggcagcgccccttcgatcggtgagcctctcgtctcgatcccccaacggagccggccgaattcgcgaggattcgggaggttttccctctgcgttcgtttctgcggatgatttgttttttttttcttttggtggatcggtttgatcgaggggagacgttgaccttgggggtttgtttctgatgatcgattgatgatttgattcgcaggttggagatggccaggacttccttcaagctcgagcacccactgggtttgttgcttcttctctctcgccccattacctctttgccctgtcaatttgttgcgattaggttgcaatctgtgattcgatcgatggtgtggtggtagattgattgcgagtttgtagatgggcgttttataatcggaactagctttgcgtttttgtgtggtatatgatgatctgattgtagattatatatgagtactacttttgtggagactgccttgtgtgtgggattgttttgtcgggcgttgtgtttgttgttggagtatgatttggcccacccaaggattgattttttcttttggttgcgtgtgttgcatattggtcttgagctgttttttagttgcagaagaggactctgtagtttacggtcgcttgtttccagaacaaaagtttaaactctgggatacttgttttattcccagttgcaaaagggtttttcatcatattcggactaacacaatgcttattgtatagatttttgtcggtagttctattactcgtaacacaatgcttattcttcggtagttccattactcgtggcagataacatcaaatgtccaattaagcaaacatatttgttcttgttgatctagtctgttttatgattgaattgtgttcaatgcgcattgttgtttcaataataaactgtttcatgtattgaacttgtttacttcagtcttcaatatatcatgattctcttgattagcagtaccctgtttactggtggttggaacatgctgtactttgtatttatttgattgagccttgaacatatttgctaatctaagaaaagctagcttgtacaagaggttgagatgatattttttcttctatttatctgctttacacttagcacagattacccctaattccattagtgtagcagaaccaactgtgaaaagaaaaaaaaaacattcccgactatgtttatgtcaaccacatgtaatttgcatatagcatcttatgatgtttgtattttgaatgatattgcagaaaggaggcaagcagaatctgccaggatccgtgagaagtactcagacagaattccggtaatatatctctgctgtttactttttcgtttgtgcatatctcctatatgcatctgtcttatcaaaaattctgcgatatgctatttcaggtgatcgttgagaaggctgacaagaccgatgttccagaaattgacaaaaagaagtaagctttcttttccacatctcctttattatgacgggagatgttctatctcatggttgcttatatcagctactaaagctttttttttatgtatgagagggcttccatttttcctctcctttttaacacctgctttagttggaggaagataaaataggagcaacttttctttcacattgggttctatctaactcaatcaggcctaatttcgctttagatgtcctgtattctctggaatttggcttgctatgttctatttgtttggttagtacttagtactctttatttatgttgcttattgacttagaatacccaggcatctgctattaattgaattgaaatcctgaaatattaaccttctcttggatacacacatctttgttttttttttctgatgtaggtaccttgtccctgctgatcttactgttggccagtttgtctatgtggttcggaagaggattaagcttagcccagaaaaggccatctttgtctttgtgaagaacacattgccgccaactggtaaattcattgttcttgatttgtcattgtcatatcacctacccttttggtttccttatattttgcgcatacattctattggcagcttctttgatgtctgcaatctacgaagagaacaaggatgaggacggcttcctctacatgacttacagtggcgagaacacattcggctctgcgtaattcatcaactgttgctgctgctgtaaataaacatggatggccaggtgtcatggtcaacctcctgtgtacatagcatgtccctgtgctggattgcctcaatggtctaatgcgtccttagctttttaagtggttcgtatgctatcgtttgaaagttggaacgacccatagaactgatattattcattctgggttgatgacgtttcttattctaccattatgcatttgcaacgtgttttaagtctgaagtgtgattgggcgtttcaatttcagttatctgttatcattgttaattgcaactgattcaggccaataagaaatcaaggccttcttaatcgtcatatctcgcatggttgcacgcatgattgttttttttttttggtagttgttgttgatgttggagactgcaccgtgttttcttctcgtctcattccatcagttattttcattttatcaatttggtgttt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0512200, RefSeq:Os07g0512200