Difference between revisions of "Os01g0257300"
Mayamei0424 (talk | contribs) (→Function) |
(→References) |
||
| Line 19: | Line 19: | ||
==References== | ==References== | ||
Please input cited references here. | Please input cited references here. | ||
| + | *Ye Han;Hong Cao;Jiafu Jiang;Yunyuan Xu;Jizhou Du;Xin Wang;Ming Yuan;Zhiyong Wang;Zhihong Xu and Kang Chong | ||
| + | Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855 | ||
| + | *Lei Ge;Hui Chen;Jia-Fu Jiang;Yuan Zhao;Ming-Li Xu;Yun-Yuan Xu;Ke-hui Tan;Zhi-Hong Xu and Kang Chong | ||
| + | Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity | ||
| + | Plant Physiology, 2004, 135(3): 1502-1513 | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 14:57, 30 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating root development yet.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
- Ye Han;Hong Cao;Jiafu Jiang;Yunyuan Xu;Jizhou Du;Xin Wang;Ming Yuan;Zhiyong Wang;Zhihong Xu and Kang Chong
Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855
- Lei Ge;Hui Chen;Jia-Fu Jiang;Yuan Zhao;Ming-Li Xu;Yun-Yuan Xu;Ke-hui Tan;Zhi-Hong Xu and Kang Chong
Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513
Structured Information
| Gene Name |
Os01g0257300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001049166.1 GI:115435745 GeneID:4326229 |
| Length |
785 bp |
| Definition |
Oryza sativa Japonica Group Os01g0257300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:8585137..8585921 |
| Sequence Coding Region |
8585497..8585826 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq> |
| Gene Sequence |
<dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica> |
| External Link(s) |
