Difference between revisions of "Os02g0674800"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F). However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs [2], suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H). '''Roc5''' has no transcription activity in yeast [2] and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' [2,3]. '''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity.[[File:Fig.1.jpg|200px|thumb|right|Fig.1 oul1 has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
 
The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F). However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs [2], suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H). '''Roc5''' has no transcription activity in yeast [2] and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' [2,3]. '''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity.[[File:Fig.1.jpg|200px|thumb|right|Fig.1 oul1 has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
]]
+
]][[File:Example.jpg]]
  
 
===Expression===
 
===Expression===

Revision as of 15:40, 30 May 2014

The rice gene Os02g0674800 is usually called Roc5 or oul1. It encodes a protein belonging to the gene family of the Homeodomain Leucine Zipper Class IV, which controls the phynotype "Leaf Rolling" in rice.

Annotated Information

Function

The Roc5 T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F). However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that Roc5 plays a role in bulliform cell fate but not its patterning. Consistent with this role, Roc5 is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs [2], suggesting that Roc5 may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis. Although Roc5 has no classical nuclear localization signal, transient expression in onion cells showed that Roc5 is a nuclear protein (Fig. 2, C–H). Roc5 has no transcription activity in yeast [2] and was a negative regulator in bulliform cell formation, suggesting that Roc5 may function as a transcriptional repressor. Phylogenetic analyses grouped Roc5 into a subfamily with Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1 [2,3]. Roc5’s closest homolog is maize OCL1, with 85.1% amino acid identity.
Fig.1 oul1 has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
Example.jpg

Expression

Roc5’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1. BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France

2. Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan       

3 Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China

References

1. Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.

2. Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507

3. Khaled AS, Vernoud V, Ingram GC, Perez P, Sarda X, Rogowsky PM. Engrailed-ZmOCL1 fusions cause a transient reduction of kernel size in maize. Plant Mol Biol 2005;58:123-39.

Structured Information

Gene Name

Os02g0674800

Description

Similar to OCL1 homeobox protein

Version

NM_001054253.1 GI:115447876 GeneID:4330297

Length

7048 bp

Definition

Oryza sativa Japonica Group Os02g0674800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28374727..28381774

Sequence Coding Region

28375293..28375646,28376807..28377180,28377409..28377586,28379246..28379473,28379583..28379684
,28379783..28380499,28380638..28380755,28380868..28381112,28381222..28381320

Expression

GEO Profiles:Os02g0674800

Genome Context

<gbrowseImage1> name=NC_008395:28374727..28381774 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28374727..28381774 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagctttgggggcctctttgacggcggcggcgggggaggcatgcagttccctttcgccagtggcttcgcgtcctcgccggcgctctccctcgcgctggacaacgccggcggtggcatcggcgggcggatgctcggcggcggcgctggcgctggttctagcgcgggcggcgcgatgacgagggacactgaggcggagaacgacagccggtcgggaagcgaccatctcgacgccatctcggccgccggcgaggacgacgtcgaggacgccgagcccagcaactcccgcaagaggaagaagcgataccaccgccacacgccgcagcagatccaagagctcgaagcgctgttcaaggagtgcccccatccggacgagaagcagcgcgccgagctcagcaggaggctctccctcgatgcgcggcaggtcaagttctggttccagaatcgccgcacgcagatgaagacgcaactggagcggcacgagaacgcgcttctcaagcaggagaacgacaagctgcgcgccgagaacatgacgatccgggaggcgatgcgcagcccaatgtgcggcagctgcgggagccccgccatgctcggggaggtgtccctagaggagcagcacctgcgcatcgagaatgcgcgcctcaaggacgagctcaaccgcgtgtgcgccctcgccaccaagttcctaggcaagcccatctccctcctgtcgccgccgcccttgctgcagccgcacctctcgctgcctatgcctaactcgtcgctggagctagcgatcggaggcatcggtggcttagggtctctcggtacactacccggctgtatgaatgagttcgccggaggcgtgtcgagcccgatgggcacggtgatcacgcctgcgcgcgcaaccggggctgctataccatcgctggtgggtaacatcgacaggtccgtgttcttagagcttgcaatcagcgcgatggacgaacttgtcaagatggcacagatggacgatccattgtgggttccggcactgcctggttctcccagcaaggaggtgctcaactttgaggagtatcttcactccttcctaccgtgcattggcatgaagcctgccggctacgtctctgaggcctcgagggaatccggtctagtcatcatcgacaacagccttgcccttgtagagaccctcatggatgagagacggtggtctgacatgttctcgtgcatgattgctaaggcaacagtgcttgaggaggtgtctaccggcattgcaggaagcagaaatggcgcgttgctgctgatgaaggctgagctacaggtgctctcacctctagtaccaattagggaggttacatttctccggttttgtaagcagctggctgagggtgcatgggcagtagttgatgtgtccattgatggtttagtgagagatcataattctggaacggcacccacaggtggaaatgtgaagtgtaggagggtaccttccggctgtgtgatgcaagacactcccaatgggtattgcaaggtcacatgggttgagcatacggaatacgatgaggcatcagtgcaccagctctaccgtccactccttcggtctggtctcgcctttggcgccaggcgttggcttgcgacgctgcagcgccaatgcgaatgccttgccatcctcatgtcctctgctacagtgacagcaaatgactcgactgctatatcgcaagagggcaagcgaagcatgctgaagctggcacgccggatgacggagaacttctgtgctggggtgagcgcatcgtctgcacgtgaatggagcaagctggatggtgcgaccggtagcatcggggaggacgtgcgcgtgatggcacggaagagcgtgagcgagcctggagagccaccgggcgtggtgctgagcgcggccacctcggtgtgggtgcccgtggctccggagaagctcttcaacttcctgcgcgatgagcagctgcgtgcggagtgggacatcctcagcaatggaggccccatgcaggagatgacccagatcgccaaggggcagcgggatgggaactcggtttcactcctcagggccagtgctgtgagtgccaaccagagcagcatgctgatacttcaggagacgtgcaccgacgcttctggctccattgttgtgtacgctccggtagacatcccggcaatgcagcttgtcatgaatggtggcgactccacctatgttgctctgcttccatccggattcgccatcctgcccgatgggcctcgcatcggcgccaccgggtacgagacgggcggctctctgctcaccgtggcgttccagattcttgtcaacaaccagcccaccgccaagctcaccgtggaatcggtcgagaccgtgaacaatctcatctcctgcaccatcaagaagatcaagacggcgctgcagtgcgacgcctga</cdnaseq>

Protein Sequence

<aaseq>MSFGGLFDGGGGGGMQFPFASGFASSPALSLALDNAGGGIGGRM LGGGAGAGSSAGGAMTRDTEAENDSRSGSDHLDAISAAGEDDVEDAEPSNSRKRKKRY HRHTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMKTQLERH ENALLKQENDKLRAENMTIREAMRSPMCGSCGSPAMLGEVSLEEQHLRIENARLKDEL NRVCALATKFLGKPISLLSPPPLLQPHLSLPMPNSSLELAIGGIGGLGSLGTLPGCMN EFAGGVSSPMGTVITPARATGAAIPSLVGNIDRSVFLELAISAMDELVKMAQMDDPLW VPALPGSPSKEVLNFEEYLHSFLPCIGMKPAGYVSEASRESGLVIIDNSLALVETLMD ERRWSDMFSCMIAKATVLEEVSTGIAGSRNGALLLMKAELQVLSPLVPIREVTFLRFC KQLAEGAWAVVDVSIDGLVRDHNSGTAPTGGNVKCRRVPSGCVMQDTPNGYCKVTWVE HTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCECLAILMSSATVTANDSTAISQ EGKRSMLKLARRMTENFCAGVSASSAREWSKLDGATGSIGEDVRVMARKSVSEPGEPP GVVLSAATSVWVPVAPEKLFNFLRDEQLRAEWDILSNGGPMQEMTQIAKGQRDGNSVS LLRASAVSANQSSMLILQETCTDASGSIVVYAPVDIPAMQLVMNGGDSTYVALLPSGF AILPDGPRIGATGYETGGSLLTVAFQILVNNQPTAKLTVESVETVNNLISCTIKKIKT ALQCDA</aaseq>

Gene Sequence

<dnaseqindica>6129..6482#4595..4968#4189..4366#2302..2529#2091..2192#1276..1992#1020..1137#663..907#455..553#ctggttctatttttctctcgcgtccacacgacgggggggcctcctctcctctccctcctcccctcgtctccacactagacttgccattttgaccctccgcttgctccctcctcccgttcctatctccccgccgccgtacataagtgctttctttaatcggatgcgtcccctcccctcgccaccagttcgttcgctcgctcgctcgctcgctcgccttgttaatctatccctccctctctcccgcccctccgtccgccgtggagggttagggttttgagggttcgctcgcctcggcgaggctttatctctctaccagtagtctcttactcttcttcgttgggccgtgggttaggaatcgggttgtgaggcgtgtgggaggggcggggtagatccaaggaagaggactttctcgagtttacgccgtggtgttttgcttcggcgaggaggcggcggcatgagctttgggggcctctttgacggcggcggcgggggaggcatgcagttccctttcgccagtggcttcgcgtcctcgccggcgctctccctcgcgctggtatgcgttcggcggctgtcgcggaccggggttgcgtcagctgttcgtagacacgagagttttctcctcgatcgagaggttattgattgattctctattttgttgacaggacaacgccggcggtggcatcggcgggcggatgctcggcggcggcgctggcgctggttctagcgcgggcggcgcgatgacgagggacactgaggcggagaacgacagccggtcgggaagcgaccatctcgacgccatctcggccgccggcgaggacgacgtcgaggacgccgagcccagcaactcccgcaagaggaagaagcgataccaccgccacacgccgcagcagatccaagagctcgaagcgtaaagcaaattcccctctcaacgctcgctcgtactttgcatccttctcctctgtgccaacctttttctctttgtcctctcatgcatggatcgatgcgtccgtcttgtgtaggctgttcaaggagtgcccccatccggacgagaagcagcgcgccgagctcagcaggaggctctccctcgatgcgcggcaggtcaagttctggttccagaatcgccgcacgcagatgaaggtaaatcatccgcgagaacatcgcatcgtgtgccttagtcttcttctctcgtcggcgttcgagccggttcgtttcgtgcaatttcctgacacggtttcatgatccccccgcgcgcgccgcgatcttcgttttaccaagacgcaactggagcggcacgagaacgcgcttctcaagcaggagaacgacaagctgcgcgccgagaacatgacgatccgggaggcgatgcgcagcccaatgtgcggcagctgcgggagccccgccatgctcggggaggtgtccctagaggagcagcacctgcgcatcgagaatgcgcgcctcaaggacgagctcaaccgcgtgtgcgccctcgccaccaagttcctaggcaagcccatctccctcctgtcgccgccgcccttgctgcagccgcacctctcgctgcctatgcctaactcgtcgctggagctagcgatcggaggcatcggtggcttagggtctctcggtacactacccggctgtatgaatgagttcgccggaggcgtgtcgagcccgatgggcacggtgatcacgcctgcgcgcgcaaccggggctgctataccatcgctggtgggtaacatcgacaggtccgtgttcttagagcttgcaatcagcgcgatggacgaacttgtcaagatggcacagatggacgatccattgtgggttccggcactgcctggttctcccagcaaggaggtgctcaactttgaggagtatcttcactccttcctaccgtgcattggcatgaagcctgccggctacgtctctgaggcctcgagggaatccggtctagtcatcatcgacaacagccttgcccttgtagagaccctcatggatgaggtttgggctaatgtcctccacatttcgcaccgtatacttatgttccgttccaatcctataatgtactaatgttggtgttacttgcattcatttcacagagacggtggtctgacatgttctcgtgcatgattgctaaggcaacagtgcttgaggaggtgtctaccggcattgcaggaagcagaaatggcgcgttgctgctggtgagtgctgatcaacagtgctaatgttcatttatcttacatagtgtaagacgtagctaacatattttctttctgaattgttaatttttcttgtgtttgcttgcaacagatgaaggctgagctacaggtgctctcacctctagtaccaattagggaggttacatttctccggttttgtaagcagctggctgagggtgcatgggcagtagttgatgtgtccattgatggtttagtgagagatcataattctggaacggcacccacaggtggaaatgtgaagtgtaggagggtaccttccggctgtgtgatgcaagacactcccaatgggtattgcaaggtaacaactaacaagaagccatttaaatggtttctctgttctctcacaataatggttcactatgattaatgtggcagtaagtcagttaatagtattgtcatcttgtagttctgaacaggtttgctggattttttttattttttattttgaaagggactgctttttattttttattttgaaagggactgctggattttttacatcgaagtaactggtcaaagtttaccccggcgttttagagctatgttaattccactacttctccactaccactatcactatgcactgctcagaacttggggatgacgtttgtttaagagtgtgtgattagtttaatggtgcgatttgctgatgcccatgcagcatagtgttcacaagtcaaggcctaataggttaattagggttatgagcccactacccaaaataaacaattcgtttggtcaacgaggagatggagtatacaatttatttagaataattaagtgtttttgtggatccaacactgttccccaaacatgttttcttttgcttgtttattcttagctccaactttcctaggggattagatgcttctaccccttggatggtgcaccttgggtaacttcttgtccgcaatttaatcaatatgtcccttacatgttgaaatctggaccacttgctcctatttggttgaaaaattggtctctatgtccttgggttttcacaattcttaatttgatctcaatctgtggcactaatgaaggaaacattttgtttagaatttctaaggtgaacaaaccaacaacatatccggcatctaatctgtttttaatagatttgaagtaaagagcagttggatgggattagggatttcagtagaaataccacctgatctaggggcttttaggaaacatatttggttctactattcctttgtcaacttaatcacatgctggtttataatatgcacatcatgttggtgagttcattcactttcttgaagagttcagatggagaaataactcttaaactagttggcatgcacgccctaaaaataaaaaaaactagttgcacgcatcattcagaagtttgggtatatcgcatggcaatgaattaacaatgttgcactcttgatcgaaatgattgaaatttgttggctaatccatgtgcacagacatctgctgttgtttctttgtgttatttttttatgttgctcaagatatgaaaatctttcttcagtagttccctcatgtgtactcttttcccgtactgtgcactccttgctttcttgatacattatttcggatgaatccagttcttagtctgtttgcttatgaataacaacagatcaaaatgtctcaacccttaggccagatataaattagtaactaaacaaattatacgctaatgccaagttacttgttggtggtcaacagtataggttcacatctcgaggctggttaacaggcaaaccttgcacattttttacgtttctgcccctacttgaccaacagcaaagaggggaagaaaacttagggtaaaaacaaaaatgtgctctgcactgtgaagccacagtagggtgttgtattgcactgcagagctctcatctgatgtattgcacctaaagacacatgcatgtgggcgtgcatttatgggctaacggatgcatttaccctgtaggtcacatgggttgagcatacggaatacgatgaggcatcagtgcaccagctctaccgtccactccttcggtctggtctcgcctttggcgccaggcgttggcttgcgacgctgcagcgccaatgcgaatgccttgccatcctcatgtcctctgctacagtgacagcaaatgactcgactggtacaggaaattctgaacctctacttgccattttccatctaaaacgagctcaatttgcggaatcaactgtgcgcaaattttgcatggaattcatttcggttgacgtcattcaaacaggacaaactgaaagaatatctccattgttcgagtagaatggccagtgcagttgtaggacagatatcttggcttggaatactgataattacgtgttgcatttgatgcatgcagctatatcgcaagagggcaagcgaagcatgctgaagctggcacgccggatgacggagaacttctgtgctggggtgagcgcatcgtctgcacgtgaatggagcaagctggatggtgcgaccggtagcatcggggaggacgtgcgcgtgatggcacggaagagcgtgagcgagcctggagagccaccgggcgtggtgctgagcgcggccacctcggtgtgggtgcccgtggctccggagaagctcttcaacttcctgcgcgatgagcagctgcgtgcggagtgggacatcctcagcaatggaggccccatgcaggagatgacccagatcgccaaggggcagcgggatgggaactcggtttcactcctcagggccagtgtgagtatttgctaccccaaatctgctctaaacatttcttcttttgtgcggtgcctaactggatagtactactgtatatagtaaaacgtagagtaattttttagcagtacgtgccatcaatttcgaacaaaacagcacagtagataaggctaaccattttcggtggtctcttccgacacaagcctgcacacaagctggtatgctgtatgtattgcattaatcacaagtatgggccaatgtaatgtaggtgtgcgttccatttctaggtgatgggtgggctattaattctaaagttattccaccttattcgtttgttaacttgctataggcctatagtagacgatttaaagttcttggtctgtagtatttattagtagcccttttcttatcttcaacccaaactctacttagcactgcacttaatcacttatatactgatcagtgcattgacaagaagattgctgaaagctaggtagagacattgtgcctaacaaagaaaagtttataagttcccgtagcctaaatgagaggttagcaagttttgtgagacctctactaatgtctttcctttccagaaaaaaaggctactcctgtctaaactatgaacaccgtacccgataaccaatattgtaaactgacgatgacatggagaagatcacaaacaaaaagtctggcaactttccatcagatattgttcggttagagaaaaaagggtcgtaatcaaggcccgactagaacgactagcaccgaactttacacgaggtctgcagaagaggacaaactaggacagaacagggtaggaaacgcagatctgcttgaaaaaggtgtcaggttgacaacttgcactactgtgttgtgtgtgtaccatgcgttagcatgcatccggatcctgtatgcagatcatgattccagggactgcttgacaagaaaaacataggaaaaacaaatcctccaaacactagcatctccggataatgaggctaatgtctgaactgtttatgactggtcagatgttaactagtctcgcgggtacaatgtcactattaaatttcgttctttacccccatgaatccttttctctaattatgttgcttctgtagttcataatattttgcagaaaataaaacaagatattttcttttttaccttttctgatgcaggctgtgagtgccaaccagagcagcatgctgatacttcaggagacgtgcaccgacgcttctggctccattgttgtgtacgctccggtagacatcccggcaatgcagcttgtcatgaatggtggcgactccacctatgttgctctgcttccatccggattcgccatcctgcccgatgggcctcgcatcggcgccaccgggtacgagacgggcggctctctgctcaccgtggcgttccagattcttgtcaacaaccagcccaccgccaagctcaccgtggaatcggtcgagaccgtgaacaatctcatctcctgcaccatcaagaagatcaagacggcgctgcagtgcgacgcctgagtgtttacagtggatttatgtccgcggggatacgccggcggcgacgagcctgagtcaagaacgaaccgcgcgttgaaaaaagaaaataacctttgctaggtgataaggatcttgcttggccggtccttagcacagagcaatggtggtggttcgggtattgactctggcctctaccgtacgccgatctctccccggcagccggtgatcattggatgatacagtaccatgcattttggacatttcttcgaggggttaaacttatgctttagtttcgtcgtcttagggagtcaaacctgtatacttttggcagttggctcatcgttgctctagtgttgtttgttttttgttgtgctatggctgtatgaggtagcctgtactagtagtttctcggaaatgctgggttcatactgtactagtgtcgtccatacttcatataggttatggtacaagtgtaggatcaaattgaaggtttcagaaagtgtatcagccaataatgtctgtttgacagtggcattgctatggatcagctgaaaattgttttttgcaatacacatgggatcaaagct</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0674800, RefSeq:Os02g0674800