Difference between revisions of "Os02g0674800"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 15: Line 15:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
1.BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France  
+
*1.BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France  
2.Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan
+
*2.Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan
3.Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China
+
*3.Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China
  
 
==References==
 
==References==

Revision as of 16:47, 30 May 2014

The rice gene Os02g0674800 is usually called Roc5 or oul1. It encodes a protein belonging to the gene family of the Homeodomain Leucine Zipper Class IV, which controls the phynotype "Leaf Rolling" in rice[1]..

Annotated Information

Function

The Roc5 T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F). However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that Roc5 plays a role in bulliform cell fate but not its patterning. Consistent with this role, Roc5 is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs [2], suggesting that Roc5 may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis. Although Roc5 has no classical nuclear localization signal, transient expression in onion cells showed that Roc5 is a nuclear protein (Fig. 2, C–H). Roc5 has no transcription activity in yeast [2] and was a negative regulator in bulliform cell formation, suggesting that Roc5 may function as a transcriptional repressor. Phylogenetic analyses grouped Roc5 into a subfamily with Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1 [3].Roc5’s closest homolog is maize OCL1, with 85.1% amino acid identity.
Fig.1 oul1 has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
Fig.2 Roc5 characterization and nuclear localization of Roc5 in onion epidermal cells. C to H, 35S::Roc5-GFP (C–E) and 35S::GFP (F–H) constructs were transiently expressed in onion epidermal cells, showing bright-field (C and F), GFP (D and G), and merged (E and H) signals.
Fig.3 Enhanced or suppressed expression of Roc5 leads to adaxially or abaxially rolled leaves, respectively. A, qRT-PCR analysis of Roc5 expression shows that the two independent overexpression lines (ox1 and ox2) had higher expression levels than the wild type (wt), whereas cosuppression(cs1 and cs2) transcripts were lower than the wild type, with the expression of cs2 near the oul1 level. B, Morphological phenotypes of wildtype, oul1, ox1, ox2, cs1, and cs2 plants show that the leaves of overexpression lines were adaxially rolled and cosuppression lines were abaxially rolled, whereas those of the wild type were flat. ab, Abaxial; ad, adaxial. Bars = 10 cm (top) and 5 mm (middle and bottom). C to N, Toluidine blue O-stained adaxial epidermal peels abutting large (C–H) or small (I–N) veins of the wild type (C and I) and oul1, ox1, ox2, cs1, and cs2 (D–H and J–N) showing purple-stained bulliform cells. O to T, Cross sections of leaves show that, compared with the wild type (O), bulliform cells in ox1 (Q) and ox2 (R) were smaller, whereas those in cs1 (S) and cs2 (T) plants were larger, with cs2 (T) similar to oul1 (P). Red lines highlight the bulliform cells. Bars = 20 mm (C–T). U and V, Measurement of numbers (U) and area (V) of bulliform cells in the wild type, ox1, ox2, cs1, and cs2. Data show means of biological replicates with SD (n>30).

Expression

Roc5’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • 1.BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France
  • 2.Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan
  • 3.Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China

References

  1. Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.
  2. 2.0 2.1 Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref2.2C3

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.

Structured Information

Gene Name

Os02g0674800

Description

Similar to OCL1 homeobox protein

Version

NM_001054253.1 GI:115447876 GeneID:4330297

Length

7048 bp

Definition

Oryza sativa Japonica Group Os02g0674800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28374727..28381774

Sequence Coding Region

28375293..28375646,28376807..28377180,28377409..28377586,28379246..28379473,28379583..28379684
,28379783..28380499,28380638..28380755,28380868..28381112,28381222..28381320

Expression

GEO Profiles:Os02g0674800

Genome Context

<gbrowseImage1> name=NC_008395:28374727..28381774 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28374727..28381774 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagctttgggggcctctttgacggcggcggcgggggaggcatgcagttccctttcgccagtggcttcgcgtcctcgccggcgctctccctcgcgctggacaacgccggcggtggcatcggcgggcggatgctcggcggcggcgctggcgctggttctagcgcgggcggcgcgatgacgagggacactgaggcggagaacgacagccggtcgggaagcgaccatctcgacgccatctcggccgccggcgaggacgacgtcgaggacgccgagcccagcaactcccgcaagaggaagaagcgataccaccgccacacgccgcagcagatccaagagctcgaagcgctgttcaaggagtgcccccatccggacgagaagcagcgcgccgagctcagcaggaggctctccctcgatgcgcggcaggtcaagttctggttccagaatcgccgcacgcagatgaagacgcaactggagcggcacgagaacgcgcttctcaagcaggagaacgacaagctgcgcgccgagaacatgacgatccgggaggcgatgcgcagcccaatgtgcggcagctgcgggagccccgccatgctcggggaggtgtccctagaggagcagcacctgcgcatcgagaatgcgcgcctcaaggacgagctcaaccgcgtgtgcgccctcgccaccaagttcctaggcaagcccatctccctcctgtcgccgccgcccttgctgcagccgcacctctcgctgcctatgcctaactcgtcgctggagctagcgatcggaggcatcggtggcttagggtctctcggtacactacccggctgtatgaatgagttcgccggaggcgtgtcgagcccgatgggcacggtgatcacgcctgcgcgcgcaaccggggctgctataccatcgctggtgggtaacatcgacaggtccgtgttcttagagcttgcaatcagcgcgatggacgaacttgtcaagatggcacagatggacgatccattgtgggttccggcactgcctggttctcccagcaaggaggtgctcaactttgaggagtatcttcactccttcctaccgtgcattggcatgaagcctgccggctacgtctctgaggcctcgagggaatccggtctagtcatcatcgacaacagccttgcccttgtagagaccctcatggatgagagacggtggtctgacatgttctcgtgcatgattgctaaggcaacagtgcttgaggaggtgtctaccggcattgcaggaagcagaaatggcgcgttgctgctgatgaaggctgagctacaggtgctctcacctctagtaccaattagggaggttacatttctccggttttgtaagcagctggctgagggtgcatgggcagtagttgatgtgtccattgatggtttagtgagagatcataattctggaacggcacccacaggtggaaatgtgaagtgtaggagggtaccttccggctgtgtgatgcaagacactcccaatgggtattgcaaggtcacatgggttgagcatacggaatacgatgaggcatcagtgcaccagctctaccgtccactccttcggtctggtctcgcctttggcgccaggcgttggcttgcgacgctgcagcgccaatgcgaatgccttgccatcctcatgtcctctgctacagtgacagcaaatgactcgactgctatatcgcaagagggcaagcgaagcatgctgaagctggcacgccggatgacggagaacttctgtgctggggtgagcgcatcgtctgcacgtgaatggagcaagctggatggtgcgaccggtagcatcggggaggacgtgcgcgtgatggcacggaagagcgtgagcgagcctggagagccaccgggcgtggtgctgagcgcggccacctcggtgtgggtgcccgtggctccggagaagctcttcaacttcctgcgcgatgagcagctgcgtgcggagtgggacatcctcagcaatggaggccccatgcaggagatgacccagatcgccaaggggcagcgggatgggaactcggtttcactcctcagggccagtgctgtgagtgccaaccagagcagcatgctgatacttcaggagacgtgcaccgacgcttctggctccattgttgtgtacgctccggtagacatcccggcaatgcagcttgtcatgaatggtggcgactccacctatgttgctctgcttccatccggattcgccatcctgcccgatgggcctcgcatcggcgccaccgggtacgagacgggcggctctctgctcaccgtggcgttccagattcttgtcaacaaccagcccaccgccaagctcaccgtggaatcggtcgagaccgtgaacaatctcatctcctgcaccatcaagaagatcaagacggcgctgcagtgcgacgcctga</cdnaseq>

Protein Sequence

<aaseq>MSFGGLFDGGGGGGMQFPFASGFASSPALSLALDNAGGGIGGRM LGGGAGAGSSAGGAMTRDTEAENDSRSGSDHLDAISAAGEDDVEDAEPSNSRKRKKRY HRHTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMKTQLERH ENALLKQENDKLRAENMTIREAMRSPMCGSCGSPAMLGEVSLEEQHLRIENARLKDEL NRVCALATKFLGKPISLLSPPPLLQPHLSLPMPNSSLELAIGGIGGLGSLGTLPGCMN EFAGGVSSPMGTVITPARATGAAIPSLVGNIDRSVFLELAISAMDELVKMAQMDDPLW VPALPGSPSKEVLNFEEYLHSFLPCIGMKPAGYVSEASRESGLVIIDNSLALVETLMD ERRWSDMFSCMIAKATVLEEVSTGIAGSRNGALLLMKAELQVLSPLVPIREVTFLRFC KQLAEGAWAVVDVSIDGLVRDHNSGTAPTGGNVKCRRVPSGCVMQDTPNGYCKVTWVE HTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCECLAILMSSATVTANDSTAISQ EGKRSMLKLARRMTENFCAGVSASSAREWSKLDGATGSIGEDVRVMARKSVSEPGEPP GVVLSAATSVWVPVAPEKLFNFLRDEQLRAEWDILSNGGPMQEMTQIAKGQRDGNSVS LLRASAVSANQSSMLILQETCTDASGSIVVYAPVDIPAMQLVMNGGDSTYVALLPSGF AILPDGPRIGATGYETGGSLLTVAFQILVNNQPTAKLTVESVETVNNLISCTIKKIKT ALQCDA</aaseq>

Gene Sequence

<dnaseqindica>6129..6482#4595..4968#4189..4366#2302..2529#2091..2192#1276..1992#1020..1137#663..907#455..553#ctggttctatttttctctcgcgtccacacgacgggggggcctcctctcctctccctcctcccctcgtctccacactagacttgccattttgaccctccgcttgctccctcctcccgttcctatctccccgccgccgtacataagtgctttctttaatcggatgcgtcccctcccctcgccaccagttcgttcgctcgctcgctcgctcgctcgccttgttaatctatccctccctctctcccgcccctccgtccgccgtggagggttagggttttgagggttcgctcgcctcggcgaggctttatctctctaccagtagtctcttactcttcttcgttgggccgtgggttaggaatcgggttgtgaggcgtgtgggaggggcggggtagatccaaggaagaggactttctcgagtttacgccgtggtgttttgcttcggcgaggaggcggcggcatgagctttgggggcctctttgacggcggcggcgggggaggcatgcagttccctttcgccagtggcttcgcgtcctcgccggcgctctccctcgcgctggtatgcgttcggcggctgtcgcggaccggggttgcgtcagctgttcgtagacacgagagttttctcctcgatcgagaggttattgattgattctctattttgttgacaggacaacgccggcggtggcatcggcgggcggatgctcggcggcggcgctggcgctggttctagcgcgggcggcgcgatgacgagggacactgaggcggagaacgacagccggtcgggaagcgaccatctcgacgccatctcggccgccggcgaggacgacgtcgaggacgccgagcccagcaactcccgcaagaggaagaagcgataccaccgccacacgccgcagcagatccaagagctcgaagcgtaaagcaaattcccctctcaacgctcgctcgtactttgcatccttctcctctgtgccaacctttttctctttgtcctctcatgcatggatcgatgcgtccgtcttgtgtaggctgttcaaggagtgcccccatccggacgagaagcagcgcgccgagctcagcaggaggctctccctcgatgcgcggcaggtcaagttctggttccagaatcgccgcacgcagatgaaggtaaatcatccgcgagaacatcgcatcgtgtgccttagtcttcttctctcgtcggcgttcgagccggttcgtttcgtgcaatttcctgacacggtttcatgatccccccgcgcgcgccgcgatcttcgttttaccaagacgcaactggagcggcacgagaacgcgcttctcaagcaggagaacgacaagctgcgcgccgagaacatgacgatccgggaggcgatgcgcagcccaatgtgcggcagctgcgggagccccgccatgctcggggaggtgtccctagaggagcagcacctgcgcatcgagaatgcgcgcctcaaggacgagctcaaccgcgtgtgcgccctcgccaccaagttcctaggcaagcccatctccctcctgtcgccgccgcccttgctgcagccgcacctctcgctgcctatgcctaactcgtcgctggagctagcgatcggaggcatcggtggcttagggtctctcggtacactacccggctgtatgaatgagttcgccggaggcgtgtcgagcccgatgggcacggtgatcacgcctgcgcgcgcaaccggggctgctataccatcgctggtgggtaacatcgacaggtccgtgttcttagagcttgcaatcagcgcgatggacgaacttgtcaagatggcacagatggacgatccattgtgggttccggcactgcctggttctcccagcaaggaggtgctcaactttgaggagtatcttcactccttcctaccgtgcattggcatgaagcctgccggctacgtctctgaggcctcgagggaatccggtctagtcatcatcgacaacagccttgcccttgtagagaccctcatggatgaggtttgggctaatgtcctccacatttcgcaccgtatacttatgttccgttccaatcctataatgtactaatgttggtgttacttgcattcatttcacagagacggtggtctgacatgttctcgtgcatgattgctaaggcaacagtgcttgaggaggtgtctaccggcattgcaggaagcagaaatggcgcgttgctgctggtgagtgctgatcaacagtgctaatgttcatttatcttacatagtgtaagacgtagctaacatattttctttctgaattgttaatttttcttgtgtttgcttgcaacagatgaaggctgagctacaggtgctctcacctctagtaccaattagggaggttacatttctccggttttgtaagcagctggctgagggtgcatgggcagtagttgatgtgtccattgatggtttagtgagagatcataattctggaacggcacccacaggtggaaatgtgaagtgtaggagggtaccttccggctgtgtgatgcaagacactcccaatgggtattgcaaggtaacaactaacaagaagccatttaaatggtttctctgttctctcacaataatggttcactatgattaatgtggcagtaagtcagttaatagtattgtcatcttgtagttctgaacaggtttgctggattttttttattttttattttgaaagggactgctttttattttttattttgaaagggactgctggattttttacatcgaagtaactggtcaaagtttaccccggcgttttagagctatgttaattccactacttctccactaccactatcactatgcactgctcagaacttggggatgacgtttgtttaagagtgtgtgattagtttaatggtgcgatttgctgatgcccatgcagcatagtgttcacaagtcaaggcctaataggttaattagggttatgagcccactacccaaaataaacaattcgtttggtcaacgaggagatggagtatacaatttatttagaataattaagtgtttttgtggatccaacactgttccccaaacatgttttcttttgcttgtttattcttagctccaactttcctaggggattagatgcttctaccccttggatggtgcaccttgggtaacttcttgtccgcaatttaatcaatatgtcccttacatgttgaaatctggaccacttgctcctatttggttgaaaaattggtctctatgtccttgggttttcacaattcttaatttgatctcaatctgtggcactaatgaaggaaacattttgtttagaatttctaaggtgaacaaaccaacaacatatccggcatctaatctgtttttaatagatttgaagtaaagagcagttggatgggattagggatttcagtagaaataccacctgatctaggggcttttaggaaacatatttggttctactattcctttgtcaacttaatcacatgctggtttataatatgcacatcatgttggtgagttcattcactttcttgaagagttcagatggagaaataactcttaaactagttggcatgcacgccctaaaaataaaaaaaactagttgcacgcatcattcagaagtttgggtatatcgcatggcaatgaattaacaatgttgcactcttgatcgaaatgattgaaatttgttggctaatccatgtgcacagacatctgctgttgtttctttgtgttatttttttatgttgctcaagatatgaaaatctttcttcagtagttccctcatgtgtactcttttcccgtactgtgcactccttgctttcttgatacattatttcggatgaatccagttcttagtctgtttgcttatgaataacaacagatcaaaatgtctcaacccttaggccagatataaattagtaactaaacaaattatacgctaatgccaagttacttgttggtggtcaacagtataggttcacatctcgaggctggttaacaggcaaaccttgcacattttttacgtttctgcccctacttgaccaacagcaaagaggggaagaaaacttagggtaaaaacaaaaatgtgctctgcactgtgaagccacagtagggtgttgtattgcactgcagagctctcatctgatgtattgcacctaaagacacatgcatgtgggcgtgcatttatgggctaacggatgcatttaccctgtaggtcacatgggttgagcatacggaatacgatgaggcatcagtgcaccagctctaccgtccactccttcggtctggtctcgcctttggcgccaggcgttggcttgcgacgctgcagcgccaatgcgaatgccttgccatcctcatgtcctctgctacagtgacagcaaatgactcgactggtacaggaaattctgaacctctacttgccattttccatctaaaacgagctcaatttgcggaatcaactgtgcgcaaattttgcatggaattcatttcggttgacgtcattcaaacaggacaaactgaaagaatatctccattgttcgagtagaatggccagtgcagttgtaggacagatatcttggcttggaatactgataattacgtgttgcatttgatgcatgcagctatatcgcaagagggcaagcgaagcatgctgaagctggcacgccggatgacggagaacttctgtgctggggtgagcgcatcgtctgcacgtgaatggagcaagctggatggtgcgaccggtagcatcggggaggacgtgcgcgtgatggcacggaagagcgtgagcgagcctggagagccaccgggcgtggtgctgagcgcggccacctcggtgtgggtgcccgtggctccggagaagctcttcaacttcctgcgcgatgagcagctgcgtgcggagtgggacatcctcagcaatggaggccccatgcaggagatgacccagatcgccaaggggcagcgggatgggaactcggtttcactcctcagggccagtgtgagtatttgctaccccaaatctgctctaaacatttcttcttttgtgcggtgcctaactggatagtactactgtatatagtaaaacgtagagtaattttttagcagtacgtgccatcaatttcgaacaaaacagcacagtagataaggctaaccattttcggtggtctcttccgacacaagcctgcacacaagctggtatgctgtatgtattgcattaatcacaagtatgggccaatgtaatgtaggtgtgcgttccatttctaggtgatgggtgggctattaattctaaagttattccaccttattcgtttgttaacttgctataggcctatagtagacgatttaaagttcttggtctgtagtatttattagtagcccttttcttatcttcaacccaaactctacttagcactgcacttaatcacttatatactgatcagtgcattgacaagaagattgctgaaagctaggtagagacattgtgcctaacaaagaaaagtttataagttcccgtagcctaaatgagaggttagcaagttttgtgagacctctactaatgtctttcctttccagaaaaaaaggctactcctgtctaaactatgaacaccgtacccgataaccaatattgtaaactgacgatgacatggagaagatcacaaacaaaaagtctggcaactttccatcagatattgttcggttagagaaaaaagggtcgtaatcaaggcccgactagaacgactagcaccgaactttacacgaggtctgcagaagaggacaaactaggacagaacagggtaggaaacgcagatctgcttgaaaaaggtgtcaggttgacaacttgcactactgtgttgtgtgtgtaccatgcgttagcatgcatccggatcctgtatgcagatcatgattccagggactgcttgacaagaaaaacataggaaaaacaaatcctccaaacactagcatctccggataatgaggctaatgtctgaactgtttatgactggtcagatgttaactagtctcgcgggtacaatgtcactattaaatttcgttctttacccccatgaatccttttctctaattatgttgcttctgtagttcataatattttgcagaaaataaaacaagatattttcttttttaccttttctgatgcaggctgtgagtgccaaccagagcagcatgctgatacttcaggagacgtgcaccgacgcttctggctccattgttgtgtacgctccggtagacatcccggcaatgcagcttgtcatgaatggtggcgactccacctatgttgctctgcttccatccggattcgccatcctgcccgatgggcctcgcatcggcgccaccgggtacgagacgggcggctctctgctcaccgtggcgttccagattcttgtcaacaaccagcccaccgccaagctcaccgtggaatcggtcgagaccgtgaacaatctcatctcctgcaccatcaagaagatcaagacggcgctgcagtgcgacgcctgagtgtttacagtggatttatgtccgcggggatacgccggcggcgacgagcctgagtcaagaacgaaccgcgcgttgaaaaaagaaaataacctttgctaggtgataaggatcttgcttggccggtccttagcacagagcaatggtggtggttcgggtattgactctggcctctaccgtacgccgatctctccccggcagccggtgatcattggatgatacagtaccatgcattttggacatttcttcgaggggttaaacttatgctttagtttcgtcgtcttagggagtcaaacctgtatacttttggcagttggctcatcgttgctctagtgttgtttgttttttgttgtgctatggctgtatgaggtagcctgtactagtagtttctcggaaatgctgggttcatactgtactagtgtcgtccatacttcatataggttatggtacaagtgtaggatcaaattgaaggtttcagaaagtgtatcagccaataatgtctgtttgacagtggcattgctatggatcagctgaaaattgttttttgcaatacacatgggatcaaagct</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0674800, RefSeq:Os02g0674800