Difference between revisions of "Os01g0703600"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
''SPL28'' encodes a clathrin-associated adaptor protein complex 1, medium subunit μ1 (AP1M1) and is responsible for spotted leaf and early senescence in rice.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
A novel rice (''Oryza sativa'') spotted leaf mutant (''spl28'') that displays a lesion mimic phenotype in the absence of pathogen attack was isolated through treatment of Hwacheongbyeo (an elite Korean japonica cultivar) with N-methyl-N-nitrosourea (MNU). Early stage development of the ''spl28'' mutant was normal. However, after flowering, spl28 mutants exhibited a significant decrease in chlorophyll content, soluble protein content, and photosystem II efficiency, and high concentrations of reactive oxygen species (ROS), phytoalexin, callose, and autofluorescent phenolic compounds that localized in or around the lesions. The ''spl28'' mutant also exhibited significantly enhanced resistance to rice blast and bacterial blight. Using a map-based cloning approach, ''SPL28'' was determined to encode a clathrin-associated adaptor protein complex 1, medium subunit μ1 (AP1M1), which is involved in the post-Golgi trafficking pathway. A green fluorescent protein (GFP) fusion protein of ''SPL28'' (SPL28::GFP) localized to the Golgi apparatus, and expression of ''SPL28'' complemented the membrane trafficking defect of apm1-1Δ yeast mutants. ''SPL28'' was ubiquitously expressed and contained a highly conserved adaptor complex medium subunit (ACMS) family domain. ''SPL28'' appears to be involved in the regulation of vesicular trafficking, and ''SPL28'' dysfunction causes the formation of hypersensitive response (HR)-like lesions, leading to the initiation of leaf senescence <ref name="ref1" />.
  
 
===Expression===
 
===Expression===
Line 14: Line 14:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Department of Plant Science, Research Institute for Agriculture and Life Sciences, and Plant Genomics and Breeding Institute, Seoul National University, Seoul, 151-921, Republic of Korea;
 +
*Crop Environment and Biotechnology Division, National Institute of Crop Science, RDA, Suwon, 441-857, Republic of Korea;
 +
*Key Laboratory of Crop Germplasm Resources and Biotechnology, Ministry of Agriculture, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Qiao YL, et al. (2010) ''SPL28'' encodes a clathrin‐associated adaptor protein complex 1, medium subunit μ1 (AP1M1) and is responsible for spotted leaf and early senescence in rice (''Oryza sativa''). New phytologist 185: 258-274.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 01:45, 31 May 2014

SPL28 encodes a clathrin-associated adaptor protein complex 1, medium subunit μ1 (AP1M1) and is responsible for spotted leaf and early senescence in rice.

Annotated Information

Function

A novel rice (Oryza sativa) spotted leaf mutant (spl28) that displays a lesion mimic phenotype in the absence of pathogen attack was isolated through treatment of Hwacheongbyeo (an elite Korean japonica cultivar) with N-methyl-N-nitrosourea (MNU). Early stage development of the spl28 mutant was normal. However, after flowering, spl28 mutants exhibited a significant decrease in chlorophyll content, soluble protein content, and photosystem II efficiency, and high concentrations of reactive oxygen species (ROS), phytoalexin, callose, and autofluorescent phenolic compounds that localized in or around the lesions. The spl28 mutant also exhibited significantly enhanced resistance to rice blast and bacterial blight. Using a map-based cloning approach, SPL28 was determined to encode a clathrin-associated adaptor protein complex 1, medium subunit μ1 (AP1M1), which is involved in the post-Golgi trafficking pathway. A green fluorescent protein (GFP) fusion protein of SPL28 (SPL28::GFP) localized to the Golgi apparatus, and expression of SPL28 complemented the membrane trafficking defect of apm1-1Δ yeast mutants. SPL28 was ubiquitously expressed and contained a highly conserved adaptor complex medium subunit (ACMS) family domain. SPL28 appears to be involved in the regulation of vesicular trafficking, and SPL28 dysfunction causes the formation of hypersensitive response (HR)-like lesions, leading to the initiation of leaf senescence [1].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Plant Science, Research Institute for Agriculture and Life Sciences, and Plant Genomics and Breeding Institute, Seoul National University, Seoul, 151-921, Republic of Korea;
  • Crop Environment and Biotechnology Division, National Institute of Crop Science, RDA, Suwon, 441-857, Republic of Korea;
  • Key Laboratory of Crop Germplasm Resources and Biotechnology, Ministry of Agriculture, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China

References

  1. Qiao YL, et al. (2010) SPL28 encodes a clathrin‐associated adaptor protein complex 1, medium subunit μ1 (AP1M1) and is responsible for spotted leaf and early senescence in rice (Oryza sativa). New phytologist 185: 258-274.

Structured Information

Gene Name

Os01g0703600

Description

Similar to Mu1 adaptin

Version

NM_001050536.1 GI:115439442 GeneID:4324247

Length

3941 bp

Definition

Oryza sativa Japonica Group Os01g0703600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:30922266..30926206

Sequence Coding Region

30922506..30922634,30922736..30922885,30922973..30923035,30923128..30923304,30923384..30923487
,30924730..30924837,30924924..30925020,30925128..30925225,30925306..30925447
,30925529..30925651,30925749..30925847

Expression

GEO Profiles:Os01g0703600

Genome Context

<gbrowseImage1> name=NC_008394:30922266..30926206 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:30922266..30926206 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgggcgcggtgtcggcgctgttccttctggacatcaagggccgcgtcctcgtctggcgcgactaccgcggcgacgtctccgccctccaggctgagcgcttcttcaccaagctcctcgacaaggagggcgactcggaggcgcactcgccggtggtctacgacgatgccggggtcacctacatgttcatccagcacaacaacgtgttcctactaaccgcctcccgccagaactgcaacgccgccagcatcctcctcttcctccaccgcgtcgttgatgtgttcaagcactatttcgaagagttggaggaagagtcgctgagggataactttgtcgttgtgtatgagttgcttgatgaaatgatggattttgggtacccacaatacacggaggcgaaaatcttaagtgaattcattaagacggatgcgtacaggatggaggtatcacagaggccacctatggcagtgacaaatgccgtgtcatggcggagtgagggtattcggtacaagaagaatgaagtgttcttggatgttgtggagagtgttaacattcttgttaacagcaatgggcagattgtgagatcagatgttgttggggcactgaagatgcggacatatttgagtggaatgcctgagtgcaaacttggattgaacgatagggttcttttggaggctcaaggccgagctactaaaggaaaagcaatagatcttgatgatattaaatttcaccagtgcgtgaggttggctagatttgagaatgatagaactatatccttcatacctcctgacggatctttcgatctaatgacatacagacttagcacccaggtaaaaccacttatctgggtggaagcacaaattgagaaacattcaagaagccgaatagaacttatggtgaaagcaagaagtcagtttaaggaaaggagcacagcaacaaatgttgaaattgaagtgcctgttccttcagatgctacgaaccctaatataagaacttcaatgggctctgctgcatatgcacctgagagagatgcaatggtctggaaagtaaaatcatttcctggtggcaaggattacatgtgcagagctgaatttagtcttccaagtataactgcagaagaagcagctcctgaaaagaaggcaccaatacgagtgaaatttgagataccatatttcactgtgtcgggtattcaggttcgctatctgaagatcattgaaaagagtgggtaccaggcgcttccttgggttagatacattacaatggctggtgaatacgaactgagacttatatga</cdnaseq>

Protein Sequence

<aaseq>MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEG DSEAHSPVVYDDAGVTYMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEEL EEESLRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAV SWRSEGIRYKKNEVFLDVVESVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLN DRVLLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQ VKPLIWVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMG SAAYAPERDAMVWKVKSFPGGKDYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPYFT VSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI</aaseq>

Gene Sequence

<dnaseqindica>241..369#471..620#708..770#863..1039#1119..1222#2465..2572#2659..2755#2863..2960#3041..3182#3264..3386#3484..3582#cgtctccactcccgatctccccgctccccgcgtcccgtctccgatccacccaaacacccgcaccgccgcgctacgcgagcacggcaccgcggcgcggcgcgactccgcaggcgacaagccgaggagaatcccgcgcccgcccgcccgcatcaccgccggatggccgccggccgtcgccggtagggcgataggcgggtagatccagatccggcggggcgggatcatatacaccccgcgccgatggcgggcgcggtgtcggcgctgttccttctggacatcaagggccgcgtcctcgtctggcgcgactaccgcggcgacgtctccgccctccaggctgagcgcttcttcaccaagctcctcgacaaggaggtaagcgctcgcgcatcccggcctctctctatctcctcgtcctcgtaggatctatgtggctcgccggtggcgttgcgcgctaagctgatgtgaaccaacagggcgactcggaggcgcactcgccggtggtctacgacgatgccggggtcacctacatgttcatccagcacaacaacgtgttcctactaaccgcctcccgccagaactgcaacgccgccagcatcctcctcttcctccaccgcgtcgttgatgtacgtatacccaccctggatcctgggacgcagatgacatgttcagcgttcagtttgttcacgaagttggtttgtgcatgagtgcaggtgttcaagcactatttcgaagagttggaggaagagtcgctgagggataactttgtcgttgtggtaagtaatggtgcaagcagctaagcatcactctggtttgctgcacaatctactggatttgacacaagatggtgtttgatttgtgcctgcagtatgagttgcttgatgaaatgatggattttgggtacccacaatacacggaggcgaaaatcttaagtgaattcattaagacggatgcgtacaggatggaggtatcacagaggccacctatggcagtgacaaatgccgtgtcatggcggagtgagggtattcggtacaagaagaatgaagtaagatacaggctcactctgttattttgggtagttttgtgatggtgctttccaaattatctaaccgatgtgtttccaggtgttcttggatgttgtggagagtgttaacattcttgttaacagcaatgggcagattgtgagatcagatgttgttggggcactgaagatgcggacatatttgaggtgagcctacaatgttattgtggaactagtagtatgatatctggatctgtaattcaatagggatcacatttatatgagtgaacattcagggtaccttcaatcggatctcaccaatagatgaagtgtccaacctaattgcccatttagaagaccatttatcagaaaattgaactgtttaagtgatggcctaagcaaacttttttactttctttatttgtgaagtaaacgcgtcatcttacttgctggttcatatgctcatttttcctgtaatcatgcatttaatatgtatttgtattccaattgttccattcttatgtgtgtcaaactaagtattatactaccgcttcacttctgaaatttcatgattttatcatgtagccatagtgtttcattgaccttttgcctttgaaagttttcaggaagtcttattctagaaacctcttcgtctctaacagattactgcttgtagattcttctgttatgcaactagatctatcataaatcttggacaaagaaatgaaagcatgctgaatgtcttttgagctagatcaatttccatgcaatactatctgacgactttagaattggttcaaagttcaaacgtcaactattgttatatgaatttgatttgccaaggctatcacgtatttgtataaagaactgctattgccacacattaaatcatcaaggaatttgatcaaggtagaaattcactctgtaagcactacctgggagatgtgccgcaccgtttttttctaatttttaaaatgtctatgcatcttttatatcccatattcagaaagaatggtggtctctcatatgatcataaagtgacttgcagttgaaagatggacatacaatttatgacctgggaacatcgatactgcatttcaagtgtttgatgttggccatacccatcacaaaatgttagcaaatacctctaaatgtcaattatagcttcggagcctacaaattaagattattaggatataagcaatgagagtgctttgcagattaccagaatttgggagtattccgtttaatttgtttcagatgtctaccttttagcagacattctgaactgatcatctgatgatgctcatgcgccatgctccccatcgaattatgttttccatctatgtttcaaagttcaaattatttgtgttatgctgtcaccccaaccatttatgttttcctgcacatctctgacccccactaatactgaacaatattgtgaatcagtggaatgcctgagtgcaaacttggattgaacgatagggttcttttggaggctcaaggccgagctactaaaggaaaagcaatagatcttgatgatattaaatttcaccagtaagtaaacagtttagcatttttttcaagtcactttgacaatttgagcagggccatatatgacctctctcttctgttattactaggtgcgtgaggttggctagatttgagaatgatagaactatatccttcatacctcctgacggatctttcgatctaatgacatacagacttagcacccaggttttctctactgcttgtgatttacagctattggatgctttagatacctgaaatgcactgccttgctccgctattctcatgcctgtctttttttatatatccttaaggtaaaaccacttatctgggtggaagcacaaattgagaaacattcaagaagccgaatagaacttatggtgaaagcaagaagtcagtttaaggaaaggaggtgagcattttacaagagcaatgtttgctgttacactaatgcctcttggaaggtgacatatttcctattttcacctgcagcacagcaacaaatgttgaaattgaagtgcctgttccttcagatgctacgaaccctaatataagaacttcaatgggctctgctgcatatgcacctgagagagatgcaatggtctggaaagtaaaatcatttcctggtggcaaggtaagtttcaagccaagtcatctttgccttctacttcatgctacctagaagtgtgctaatatatgtgagtttttctgttaggattacatgtgcagagctgaatttagtcttccaagtataactgcagaagaagcagctcctgaaaagaaggcaccaatacgagtgaaatttgagataccatatttcactgtgtcgggtattcaggtaatcaaattactattgcaaatatgtacttgattgctcttatggtacttctttgctatcttcactcaaaatgtatgccatcttgtattttctgcaggttcgctatctgaagatcattgaaaagagtgggtaccaggcgcttccttgggttagatacattacaatggctggtgaatacgaactgagacttatatgagttatctctgatatggctgctcaaagattttgatgctaaatttcaactcccaagatacatgtttgatgctcgatatacaacatatagttggcattgggacgttgccatggaagtctttgaaaagctcaaccatgcaaggtttttctgtctcgttgttcatcttgttagtgttactttaccatggttactgtaagttacccatcaagtatagctttgaaaaaaactttttttttgttcacttgtatcattattgatttatttttgtgggtgtcgaactttcccccttttgtactacacaaaaatcttgagctgaattggtataaatgaaatacctgggcggtgcttttgaagtccagatt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0703600, RefSeq:Os01g0703600