Difference between revisions of "Os02g0677300"
(→Function) |
(→Expression) |
||
| Line 8: | Line 8: | ||
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
| + | CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 02:13, 31 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation(Thomashow, 2010).The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants[1].
Expression
Please input expression information here. CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation[1]. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes [2]. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) [3]. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes [4]. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato[5]; [6]; [7]; [8]. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice [9];[10].Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0677300 |
|---|---|
| Description |
Similar to CRT/DRE binding factor 1 |
| Version |
NM_001054262.1 GI:115447894 GeneID:4330306 |
| Length |
1272 bp |
| Definition |
Oryza sativa Japonica Group Os02g0677300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:28539796..28541067 |
| Sequence Coding Region |
28539841..28540515 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq> |
| Gene Sequence |
<dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica> |
| External Link(s) |
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref1.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref2.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref3.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref4.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref5.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref6.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref7.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref8.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref9.E2.80.9D - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs named.E2.80.9Dref10.E2.80.9D
