Difference between revisions of "Os01g0257300"
Mayamei0424 (talk | contribs) (→Function) |
Mayamei0424 (talk | contribs) (→References) |
||
| Line 34: | Line 34: | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | <ref name="ref1">.Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513</ref> | ||
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855 | *Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855 | ||
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513 | *Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513 | ||
Revision as of 03:15, 31 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsRAA1 (Oryza sativa Root Architecture Associated1) encodes a small protein (109 aa in length) conserved in plants including -GVWV/IF domain, -GWERYY domain ,-DLIS/ALP- and -H/YMYDI/VVV/I- domain. The OsRAA1 promoter(1,987 bp in length)includes elements of GA and auxin response, but it was a very weak response to GA3 treatment and it probably regulated by auxin. The OsRAA1 mRNA was specifically transcripted in the organs of roots and spikes, including root apex, cortex of root apical meristem ,pericycle of root apex, lateral roots, apical meristem of young spikes, collenchyma cells of margin vascular bundles between shoot and roots.In Ubi::OsRAA1 transgenic plants, overexpression OsRAA1 in the root results in reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic, which are similar to the phenotypes of the wild-type plant treated with auxin. Furthermore, the leaves and filaments are longer at the last stage of plant development in the transgenic plants. OsRAA1 expression is induced by auxin. At the same time, overexpression of OsRAA1 also causes endogenous indole-3-acetic acid to increase. These data suggest that OsRAA1 as a new gene functions in the development of rice root systems,which are mediated by auxin[1].
OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.
Expression
Please input expression information here. Immunoassay of a cell line with GFP alone showed immunofluorescence in the whole cell during the cell cycle.In contrast, in the OsRAA1-GFP transgenic line, OsRAA1 GFP was enriched at spindles, including tubulins, from metaphase to anaphase during cell division
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
- OsRAA1 Interaction Protein Screening
- OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo
- Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells
- Degradation of OsRAA1 Depends on the Proteasome
- Two-Hybrid cDNA Library Construction and Screening
- Protein Deletion Mutation and Yeast Plasmid Construction
- Pull-Down Assay
- Immunofluorescence of Rice Root Tips
- Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis
- Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line
- Transient Subcellular Localization
- Determination of the Half-Life of OsRAA1
- Protein Degradation Assay in Vitro
- Morphological Examination of Transformed S. pombeCells
References
<references> [1]
- Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855
- Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513
Structured Information
| Gene Name |
Os01g0257300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001049166.1 GI:115435745 GeneID:4326229 |
| Length |
785 bp |
| Definition |
Oryza sativa Japonica Group Os01g0257300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:8585137..8585921 |
| Sequence Coding Region |
8585497..8585826 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq> |
| Gene Sequence |
<dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica> |
| External Link(s) |