Difference between revisions of "Os01g0834400"
(→References) |
(→Evolution) |
||
| Line 18: | Line 18: | ||
===Evolution=== | ===Evolution=== | ||
| − | [[File: | + | [[File:Phylogenetic_tree_of_HAP3.png|right|thumb|350px| '''Figure 3''''' (from reference <ref name="ref2" />)'']] |
Rice has 11 HAP3 genes in its genome, the newly identified genes were named as OsHAP3D to OsHAP3D A phylogenetic analysis based on the amino acid sequeces of the conserved domain showed that the OsHAP3 proteins were located in several different clades. A comparison of amino acid sequences in the conserved domain showed that OsHAP3 proteins are 96-39% identical to each other and also to the Arabidopsis proteins. Among the proteins in the same clade, the amino acid identities increased to not less than 77(OsHAP3A clade). OsHAP3A,OsHAP3B and OsHAP3C also showed similarity in their C-terminus regions with 67-44% identity in 45-35 amino acid resudues. | Rice has 11 HAP3 genes in its genome, the newly identified genes were named as OsHAP3D to OsHAP3D A phylogenetic analysis based on the amino acid sequeces of the conserved domain showed that the OsHAP3 proteins were located in several different clades. A comparison of amino acid sequences in the conserved domain showed that OsHAP3 proteins are 96-39% identical to each other and also to the Arabidopsis proteins. Among the proteins in the same clade, the amino acid identities increased to not less than 77(OsHAP3A clade). OsHAP3A,OsHAP3B and OsHAP3C also showed similarity in their C-terminus regions with 67-44% identity in 45-35 amino acid resudues. | ||
Revision as of 10:51, 31 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The CCAAT-box is one of the most common promoter elements found in a large number of genes in plants. The HAP complex, which is also called NF-Y or CBF in animals, binds the CCAAT-box and regulates expression of genes.This complex consists of three distinct subunits: HAP2、HAP3、HAP5,all of which are necessary for DNA binding. Each subunit contains an evolutionary conserved domain that is responsible for DNA binding and protein-protein interaction. 10 genes for HAP2 subunit, 11 genes for HAP3 subunit and 7 genes for HAP5 subunit has been identified. HAP3A、HAP3B、HAP3C are genes encode subunits of HAP3. HAP3 genes regulate chloroplast biogenesis. In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, these plants showed pale green leaves, in which the amount of chlorophyll was reduced and chloroplasts were degenerated. The thylakoid membrane was hardly generated of formed only sightly along the enveolpe, no clear grana or stroma was observed and the accumulation of the starch was not evident. Instead, an electron-dense fibre-like structure was observed in the central portion of the deformed chloroplast. The chloroplast was almost empty and smaller in size.
OsHAP3A was also expressed in roots. In the antisense root, although the amount of accumulated starch was reduced, the accumulation of the starch was still observed in the amyloplasts. Showing that the OsHAP3A can also affect the amyloplast, mainly the accumulation of the starch.
a. The chloroplast of the antisense plant #31. A membrane structure of the chloroplasts was not well developed and no accumulation of starch grains was observed
b. Electron-dense fibre-like structure was observed.
c. The amyloplast of the antisense plant #31. The reduced amount of the starch was accumulated.
d. The chloroplast of the antisense plant #56. Almost no membrane structure was observed inside the chloroplast. The chloroplast was small.
e. The inside of the chloroplast was almost empty.
f. The amyloplast of the antisense plant #56. The reduced amount of the starch was accumulated.
Expression
]]RNAs isolated from indicated organs were analysed by RT-PCR. Actin was used for an internal control. OsHAP3A, OsHAP3B, OsHAP3C showed ubiquitous expression. They were expressed in all organs examined such as shoot apices, roots, young panicles, flowering panicles, young leaves, developing embryos and their surrounding tissues at 0, 2, 4, 6 and 8 Days after pollination, and regenerating calli at 0, 2, 4, 6 days after regeneration. The expression wwas also observed in developing young inflorescence with a panicle length of 1 and 3 mm, 2 and 3 cm.
Evolution
Rice has 11 HAP3 genes in its genome, the newly identified genes were named as OsHAP3D to OsHAP3D A phylogenetic analysis based on the amino acid sequeces of the conserved domain showed that the OsHAP3 proteins were located in several different clades. A comparison of amino acid sequences in the conserved domain showed that OsHAP3 proteins are 96-39% identical to each other and also to the Arabidopsis proteins. Among the proteins in the same clade, the amino acid identities increased to not less than 77(OsHAP3A clade). OsHAP3A,OsHAP3B and OsHAP3C also showed similarity in their C-terminus regions with 67-44% identity in 45-35 amino acid resudues.
Labs working on this gene
1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.
2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.
References
1.<references>[1]
2.<references>[2]
Structured Information
| Gene Name |
Os01g0834400 |
|---|---|
| Description |
Similar to HAP3 |
| Version |
NM_001185707.1 GI:297720548 GeneID:9268285 |
| Length |
2312 bp |
| Definition |
Oryza sativa Japonica Group Os01g0834400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:37512199..37514510 |
| Sequence Coding Region |
37512340..37512558 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:37512199..37514510 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:37512199..37514510 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>aagactaaagcacttgaagggtgttggtttagaaagggtgttaacagttggctgtggcgattgcttcacagatgtaaattgcttcataagtggtttaatgcttgtttttgcctgtatattcagagcaattttcacatattggtagttctgcaatcttttgcattcccatacatgtatcaggtggcacaaatctattgcaagtaccctagcattgaataa</cdnaseq> |
| Protein Sequence |
<aaseq>KTKALEGCWFRKGVNSWLWRLLHRCKLLHKWFNACFCLYIQSNF HILVVLQSFAFPYMYQVAQIYCKYPSIE</aaseq> |
| Gene Sequence |
<dnaseqindica>1953..2171#aaccgccgtctcctcctccccccactctcgccttcccccctctctctcctctcctctccgcgactccctccacccccgcgcgcgcgcgttttttttttttcgtaaggtacggatccaacgacgctgctcggctgctcctctccccaccaccatctctgatggtttgttgctgtgatgatgatgatggatctagggtttttggagggcggcgcggggatggcggacgcggggcacgacgagagcgggagcccgccgaggagcggcggggtgagggagcaggacaggttcctgcccatcgccaacatcagccgcatcatgaagaaggccgtcccggcgaacggcaagatcgccaaggacgccaaggagaccctgcaggagtgcgtctcggagttcatctccttcgtcaccagcgagtgagtctgcgcgggctcggtaccgtgatcctgccctccccacaccttcttttgtgatggttggtttagggtgtgattttgctttgctttgtggtttgggcggtggtgcgggatgggacagggcgagcgacaaatgtcagaaggagaagcgcaagaccatcaacggggaagatctcctctttgcgatgggtacgcttggctttgaggagtacgttgatccgttgaagatctatttacacaagtacagagaggtaattgtgcgcttcgtactctctgccagtataaatgttaaacctttcgttgttgtatgaatatctgatgtctcttctgtcctcctggcaaatttgcaatacgtggggatgtgcactgttaactgcagatggaggtacaccatctaccattctaccctcctcaaaatccccttttttccccaacaatatgctatggtttcatgtgaattttttttttgtcaacgcaaaaatgtgtcactcttgtaatcctgcttttagaacaatcccacaaaaaattgatatgcaattatgccctttgattagagatagttggtgctcaacatgaaatgtacatatcctactctgaactgtaaggttaacacctgaatcattctttcattcctctgcttcatatacattgaaggaaagctaaccgcatccatttagtatgtcactgttcaatttgcctggaaatatatatttgtgccttagtaatactctaagatctatatttgtgccttagtaaaagatctatttttgtgcatcaagattcaagatgtattgagttctaaccataccactattccttattcttggtagggtgatagtaagctgtcctcaaaggctggtgatggttcagtaaagaaggatacaattggtccgcacagtggcgctagtagctcaagtgcgcaaggggttggtatcagtaacttgtactgctttgttctttctgatgtttgaaaacactgacatactgataatatttttagatggttggggcttacacccaagggatgggttatatgcaacctcaggtaacctagcactagcatagtatcatttgtcagcacaatgctatggttcatccttgaagctaaacaagatataaagtaataatgcacattcaactttttttttctagctgacactgtttatgccattacacgtgcagtatcataatggggacacctaaagatgaggacagtgaaaattttcagtaactggtgtcctctgtgaggtaagatcttttgtacagaaatcatttgccatccttggggcagttttcagttagatgtttttttcactaaaaattgcccgttctgtctcaaggttcacatatactacatctgtatttttttattctttttacatgtgaactctggagatgttgagctgcacatgtgaaaaattctccgagtgcttttatactttttcgcgctcttctagttctgacacaatactcccttttgctgcagttattatccatctgttaaggaagaacccacattagggccatatttattagtagaagactaaagcacttgaagggtgttggtttagaaagggtgttaacagttggctgtggcgattgcttcacagatgtaaattgcttcataagtggtttaatgcttgtttttgcctgtatattcagagcaattttcacatattggtagttctgcaatcttttgcattcccatacatgtatcaggtggcacaaatctattgcaagtaccctagcattgaataatgctggttaacatataattctgtaacgtccgtattgtttcgactgtgatgcttgccgtatgggcaatggcatgtgttctagagggggcattcaatatttaggtatctcaagaatgtaccaaatactcccttcgttcaattc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.
- ↑ 2.0 2.1 Thiruvengadam Thirumurugan,Yukihiro Ito,Takahiko Kubo,Akiko Serizawa,Nori Kurata, Identification, characterization and interaction of HAP family genes in rice, Molecular Genetics and Genomics, 2008, 279(3): 279-289.