Os01g0257300

Please input one-sentence summary here.

Annotated Information

Function

OsRAA1(Oryza sativa Root Architecture Associated1) encodes a small protein (109 aa in length) conserved in plants including -GVWV/IF domain, -GWERYY domain ,-DLIS/ALP- and -H/YMYDI/VVV/I- domain. The OsRAA1 promoter(1,987 bp in length)includes elements of GA and auxin response, but it was a very weak response to GA3 treatment and it probably regulated by auxin. The OsRAA1 mRNA was specifically transcripted in the organs of roots and spikes, including root apex, cortex of root apical meristem ,pericycle of root apex, lateral roots, apical meristem of young spikes, collenchyma cells of margin vascular bundles between shoot and roots.In Ubi::OsRAA1 transgenic plants, overexpression OsRAA1 in the root results in reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic, which are similar to the phenotypes of the wild-type plant treated with auxin. Furthermore, the leaves and filaments are longer at the last stage of plant development in the transgenic plants. OsRAA1 expression is induced by auxin. At the same time, overexpression of OsRAA1 also causes endogenous indole-3-acetic acid to increase. These data suggest that OsRAA1 as a new gene functions in the development of rice root systems,which are mediated by auxin.

OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.

Expression

Please input expression information here. Immunoassay of a cell line with GFP alone showed immunofluorescence in the whole cell during the cell cycle.In contrast, in the OsRAA1-GFP transgenic line, OsRAA1 GFP was enriched at spindles, including tubulins, from metaphase to anaphase during cell division

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

• Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, The Chinese Academy of Sciences,Beijing 100093, China
• State Key Laboratory of Plant Physiology and Biochemistry, Department of Plant Sciences, College of Biological Sciences, China Agricultural University, Beijing 100094,China
• Department Plant Biology, Carnegie Institution of Washington, and Department of Biological Sciences, Stanford University, Stanford, California 94305
• National Research Center for Plant Gene, Beijing 100093, China
• Graduate School of the Chinese Academy of Sciences, Beijing 100049, China

References

• Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855
• Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513

Structured Information

Gene Name	Os01g0257300
Description	Conserved hypothetical protein
Version	NM_001049166.1 GI:115435745 GeneID:4326229
Length	785 bp
Definition	Oryza sativa Japonica Group Os01g0257300, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 1
Location	Chromosome 1:8585137..8585921
Sequence Coding Region	8585497..8585826
Expression	GEO Profiles:Os01g0257300
Genome Context	<gbrowseImage1> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>
Protein Sequence	<aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>
Gene Sequence	<dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>
External Link(s)	NCBI Gene:Os01g0257300, RefSeq:Os01g0257300