Difference between revisions of "Os01g0897700"
(→Function) |
(→Function) |
||
| Line 7: | Line 7: | ||
OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[3]. | OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[3]. | ||
Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation[1].Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition. | Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation[1].Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition. | ||
| + | [[File:OsFH1-1.png]] | ||
===Expression=== | ===Expression=== | ||
Revision as of 03:38, 1 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain[1].Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4,
OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[3].
Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation[1].Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0897700 |
|---|---|
| Description |
Similar to FH protein NFH1 |
| Version |
NM_001051625.1 GI:115441620 GeneID:4325107 |
| Length |
1054 bp |
| Definition |
Oryza sativa Japonica Group Os01g0897700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:40769673..40770726 |
| Sequence Coding Region |
40769990..40770463 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:40769673..40770726 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:40769673..40770726 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttga</cdnaseq> |
| Protein Sequence |
<aaseq>MDSDVLSSYVSKLAGGIEKITEVLRLNEEVKSREDAWRFHDSMQ KFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLSVLDQ VCKEVGRINDRTIASSVRHFPVPVNPMMPQLFPRIHALRAGISDDESSATSASSP</aaseq> |
| Gene Sequence |
<dnaseqindica>264..737#atcgcggcgatgcacacgcgttcaagcttgatactctactcaaattggttgatgtcaaaggcactgatggcaagactacacttttgcattttgtcgtgcaggagattatccgaacggagggctcccacctctctgctagcaaccaatcaactccacgaactcaggcaaaccctttacgggacgagctcgagtgcaaaaagcttggcctccaggtagtggctggcctcggaaacgagctcagcaatgtcaagaaggcagctgccatggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttgatcaccagtagtctgccaatagaaatttttcgcagagtactgtgggaaacctccatagggcagagggagaccaacggcgacggggtgtcaaatttttttttgaaccttttgtacctgtagattatagaatgtaagaagtttttttgcaaatatttatttctatatataagaggagataaaatctagatcagaggaggaaataagcagttcatgtgtttgtcatcttcagtctgtacatgacacgaggtagtgaaacagcctgtacaatgtactaacaatttcaagtatggccagtctgcagaattcaaaggtaagctg</dnaseqindica> |
| External Link(s) |
