Difference between revisions of "Os06g0700700"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 +
The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(''Oryza sativa'' L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. ''OsHMA2'' is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. <ref name="ref1" /> ''OsHMA2'' plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, ''OsHMA2'' is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. <ref name="ref2" /> OsHMA2 also plays a role in Zn transport during flowering and seed maturing. <ref name="ref1" />
  
 
===Expression===
 
===Expression===

Revision as of 09:34, 1 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(Oryza sativa L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. OsHMA2 is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. [1] OsHMA2 plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, OsHMA2 is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. [2] OsHMA2 also plays a role in Zn transport during flowering and seed maturing. [1]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0700700

Description

Similar to P1B-type heavy metal transporting ATPase

Version

NM_001065015.1 GI:115469761 GeneID:4341965

Length

2957 bp

Definition

Oryza sativa Japonica Group Os06g0700700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:30354951..30357907

Sequence Coding Region

30355990..30356270,30357298..30357487

Expression

GEO Profiles:Os06g0700700

Genome Context

<gbrowseImage1> name=NC_008399:30354951..30357907 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:30354951..30357907 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggagggagggaggtgtcagaagagctacttcgacgtgctggggatttgctgcccgtcggaggttcccctcgtcgagaagcttctgcagccgctggagggcgtccagaaggtcaccgtgatcgttccctccaggacggtcatcgtcgtccacgacgtcgacgccatctcccaatcccaaatcgtcaaggcgctgaatcaggcaaggttggaggcgtcggttcgggcttatgggaacggcagtgagaagatcaccaacaaatggccgagcccgtatgttctcctctgcggacttcttctggtcgtgtcgctgttcgagcatttctggcacccgctcaagtggttcgcgctggtggctgcggccgccggcttgccgccgatcgtgctgaggagcattgcggccatccggagactcaccctggatgtcaacatactcatgctgattgctggtaagaacagcctataa</cdnaseq>

Protein Sequence

<aaseq>MAAEGGRCQKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIV PSRTVIVVHDVDAISQSQIVKALNQARLEASVRAYGNGSEKITNKWPSPYVLLCGLLL VVSLFEHFWHPLKWFALVAAAAGLPPIVLRSIAAIRRLTLDVNILMLIAGKNSL</aaseq>

Gene Sequence

<dnaseqindica>1638..1918#421..610#ctatccccgattcgcacagccaatctcttcttgcttcctcctcctcctcctccagccgccgccgccgacgacgattcttggtagagagattcttgcgttgttttacctgcgtcttgttcttcttgggagttgggtggatcgattgatcgaggttttggaggttggaagaagtgtgtgttgtggtggggggtaagtgagatggagaactgaattcactgaactcattttctttccttttttttttggtctgacaagaagtaaaaattcctgaacctgaaaccaaccaaaggacaggttggtcgacacgccaagattgcttttgctgctgtgtccttctcactcttgttcttgttcttgcttcttcaggtttgtagagagagagagggcaaaggcacgcaaagagggagagagtgaggagagatggcggcggagggagggaggtgtcagaagagctacttcgacgtgctggggatttgctgcccgtcggaggttcccctcgtcgagaagcttctgcagccgctggagggcgtccagaaggtcaccgtgatcgttccctccaggacggtcatcgtcgtccacgacgtcgacgccatctcccaatcccaaatcggtgagagccccccttttttcttttttgctttccgagtggattgattcatctccctttcgtgattaagatcgatctctccttccatcttgacttgtcacttatcattgtcctgtgatcaatgaatgataccaatcatgcaaccggtgactgagccatcttgtgggatttgtggagtttttgggtgggtcaagaagtcacacgagactagaccagaccagagtctcagtaatttgaagaaaacgatcttttttattttctttgtcatggctgcttgtttgttcattggattttcgatgattttatttctgttcttgctagtttaatcagaatcttactttaattatcgcaagaaaaattggatcttaacatatatatagcgtgttgagcgatggaaagcatcacgcaaagttgcttgcgtttctcattctgttcttgctgttcatgagttgttccagtatctgtattttttttttgtttgtttgtttgtttgttcacaataaatttcatttctaatcgttgcttgattcaataactagccagccaagcaaaggtggtgtcatgtgttcgtttgttttcatggctcgaggctggggaccacttaccatgtcagaaaataagtgcaaaatttcatactccaactctactaaaatgggatgtttgctagcgacaagtgaaccgtcttggcagtggtcgctattgttcatgacgcagggagcaattactgatacgattggacatatctcttgactcgttaattctgacctcagcacccccgaaatcctgctaattttgcagtttctgtcacgagaattaaggaacttgattactgtacaatactgtcacactcaatgaaaccgccagtttttcatctttggttcttgaaacagtcattacataattttagataaatgttactgtccttgaggaggtataccaattatgacagatggacagtaaaatcaatcacgattttagcatgacaaaactcttgaaagcttgatttgattttgatatttgctgttttcagtcaaggcgctgaatcaggcaaggttggaggcgtcggttcgggcttatgggaacggcagtgagaagatcaccaacaaatggccgagcccgtatgttctcctctgcggacttcttctggtcgtgtcgctgttcgagcatttctggcacccgctcaagtggttcgcgctggtggctgcggccgccggcttgccgccgatcgtgctgaggagcattgcggccatccggagactcaccctggatgtcaacatactcatgctgattgctggtaagaacagcctataattcacctgtgacattaatgatgtttcctgttattggtaccttgaaaaaaaaagaagctcccttttgttggaggatggccctgaccatcacctccgacgatcgaagaccctttgatctttaggagataactgaattataaaattttaaataggcttccttcatctggtggcctaatgcatgcattttggcttgtaccaaaacctactttctctctttaatgaaatgaaaagcagaggtcccaccatactttttgaaaagaaatgaacgtttaaatagtatcgaatggtagcaaacacatctgccattaaggatatcctccaattgaatagtctcatttgaaataagaaaacaaattattgacacagcttagtagtagagcattgagttttaacgttgatgccatgggtttgaagcttttttttctgtattaaaagggcaacagtatacttgttcctttttttaccatagtattctcttgtgtgtagaagacacaaatacaacaccactttgggtaaatattcaactacggattgaagttgtgggtattattgatacctgttctaccagtgtgacaatgggttgtgaaaaaaaaagagacaaaagcaagtttcttcacgaggaccaatatggtgggtgattagtgggagagcagaagcagaaatccatctctcaaaagtttatgtctcacttgcataaacttttgctttcttttcttttctagagggtccctcactttccatcacatcaaaaggatatgttgctgtgatgctaatatacgtgctagatgaacaattctgcttcttttcctccatgtggcgatgtcacctcagatagggcatcagattccttttagaacaagcaacatatttcttatcaagaagctacacatatttcgaataattctttctagactaatatcgtggcattgagatagctctattgtgatatgcatatgggaatatgggatacatgaaagaatcatcaaaagaaacaagaaataccttgtttcaaaaagaaaaaaagatttggaagatttggt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0700700, RefSeq:Os06g0700700

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2