Difference between revisions of "Os06g0700700"
(→References) |
|||
| Line 11: | Line 11: | ||
The expression of OsHMA2 was observed mainly in the roots. Using LM, OsHMA2 transcripts were detected mainly in vascular bundles. Expression of OsHMA2 in the roots was unchanged in the presence of Cd, whereas expression in the shoots increased in the presence of 1 mm Cd. Under Zn deficiency, the expression of OsHMA2 decreased in the roots, whereas it remained unchanged in shoots. In contrast, the expression of OsHMA2 increased in roots under Fe deficiency, whereas it decreased in shoots. Expression of OsHMA2 was unchanged in both roots and shoots under Mn deficiency.<ref name="ref3" /> | The expression of OsHMA2 was observed mainly in the roots. Using LM, OsHMA2 transcripts were detected mainly in vascular bundles. Expression of OsHMA2 in the roots was unchanged in the presence of Cd, whereas expression in the shoots increased in the presence of 1 mm Cd. Under Zn deficiency, the expression of OsHMA2 decreased in the roots, whereas it remained unchanged in shoots. In contrast, the expression of OsHMA2 increased in roots under Fe deficiency, whereas it decreased in shoots. Expression of OsHMA2 was unchanged in both roots and shoots under Mn deficiency.<ref name="ref3" /> | ||
| + | |||
| + | ===Mutation=== | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 10:23, 1 June 2014
OsHMA2 is a transporter of Zn and Cd in rice and involved in the root-to-shoot translocation of Zn and Cd.
Contents
Annotated Information
Function
The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(Oryza sativa L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. OsHMA2 is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. [2] OsHMA2 plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, OsHMA2 is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. [3] OsHMA2 also plays a role in Zn transport during flowering and seed maturing. [2]
Expression
Total RNA was extracted from rice using the RNeasy Plant Mini Kit. The RNA was reverse transcribed using an oligo dT primer and the ReverTra Ace reverse transcriptase. Amplification reactions were carried out with the HMA2-F1 primer (5′-GCAGATCAAGTCACCCCATGG-3′) and the HMA2-R1 primer (5′-GCCATCACCAAC CATCAGCGT-3′). As an internal standard, the a-tubulin gene was used as described previously. Transcript abundance was normalized by a-tubulin expression level, and the results represent average number of copies of OsHMA2 transcripts in 1 mg of total RNA in three reactions.[1]
The expression of OsHMA2 was observed mainly in the roots. Using LM, OsHMA2 transcripts were detected mainly in vascular bundles. Expression of OsHMA2 in the roots was unchanged in the presence of Cd, whereas expression in the shoots increased in the presence of 1 mm Cd. Under Zn deficiency, the expression of OsHMA2 decreased in the roots, whereas it remained unchanged in shoots. In contrast, the expression of OsHMA2 increased in roots under Fe deficiency, whereas it decreased in shoots. Expression of OsHMA2 was unchanged in both roots and shoots under Mn deficiency.[1]
Mutation
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os06g0700700 |
|---|---|
| Description |
Similar to P1B-type heavy metal transporting ATPase |
| Version |
NM_001065015.1 GI:115469761 GeneID:4341965 |
| Length |
2957 bp |
| Definition |
Oryza sativa Japonica Group Os06g0700700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:30354951..30357907 |
| Sequence Coding Region |
30355990..30356270,30357298..30357487 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:30354951..30357907 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:30354951..30357907 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggcggagggagggaggtgtcagaagagctacttcgacgtgctggggatttgctgcccgtcggaggttcccctcgtcgagaagcttctgcagccgctggagggcgtccagaaggtcaccgtgatcgttccctccaggacggtcatcgtcgtccacgacgtcgacgccatctcccaatcccaaatcgtcaaggcgctgaatcaggcaaggttggaggcgtcggttcgggcttatgggaacggcagtgagaagatcaccaacaaatggccgagcccgtatgttctcctctgcggacttcttctggtcgtgtcgctgttcgagcatttctggcacccgctcaagtggttcgcgctggtggctgcggccgccggcttgccgccgatcgtgctgaggagcattgcggccatccggagactcaccctggatgtcaacatactcatgctgattgctggtaagaacagcctataa</cdnaseq> |
| Protein Sequence |
<aaseq>MAAEGGRCQKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIV PSRTVIVVHDVDAISQSQIVKALNQARLEASVRAYGNGSEKITNKWPSPYVLLCGLLL VVSLFEHFWHPLKWFALVAAAAGLPPIVLRSIAAIRRLTLDVNILMLIAGKNSL</aaseq> |
| Gene Sequence |
<dnaseqindica>1638..1918#421..610#ctatccccgattcgcacagccaatctcttcttgcttcctcctcctcctcctccagccgccgccgccgacgacgattcttggtagagagattcttgcgttgttttacctgcgtcttgttcttcttgggagttgggtggatcgattgatcgaggttttggaggttggaagaagtgtgtgttgtggtggggggtaagtgagatggagaactgaattcactgaactcattttctttccttttttttttggtctgacaagaagtaaaaattcctgaacctgaaaccaaccaaaggacaggttggtcgacacgccaagattgcttttgctgctgtgtccttctcactcttgttcttgttcttgcttcttcaggtttgtagagagagagagggcaaaggcacgcaaagagggagagagtgaggagagatggcggcggagggagggaggtgtcagaagagctacttcgacgtgctggggatttgctgcccgtcggaggttcccctcgtcgagaagcttctgcagccgctggagggcgtccagaaggtcaccgtgatcgttccctccaggacggtcatcgtcgtccacgacgtcgacgccatctcccaatcccaaatcggtgagagccccccttttttcttttttgctttccgagtggattgattcatctccctttcgtgattaagatcgatctctccttccatcttgacttgtcacttatcattgtcctgtgatcaatgaatgataccaatcatgcaaccggtgactgagccatcttgtgggatttgtggagtttttgggtgggtcaagaagtcacacgagactagaccagaccagagtctcagtaatttgaagaaaacgatcttttttattttctttgtcatggctgcttgtttgttcattggattttcgatgattttatttctgttcttgctagtttaatcagaatcttactttaattatcgcaagaaaaattggatcttaacatatatatagcgtgttgagcgatggaaagcatcacgcaaagttgcttgcgtttctcattctgttcttgctgttcatgagttgttccagtatctgtattttttttttgtttgtttgtttgtttgttcacaataaatttcatttctaatcgttgcttgattcaataactagccagccaagcaaaggtggtgtcatgtgttcgtttgttttcatggctcgaggctggggaccacttaccatgtcagaaaataagtgcaaaatttcatactccaactctactaaaatgggatgtttgctagcgacaagtgaaccgtcttggcagtggtcgctattgttcatgacgcagggagcaattactgatacgattggacatatctcttgactcgttaattctgacctcagcacccccgaaatcctgctaattttgcagtttctgtcacgagaattaaggaacttgattactgtacaatactgtcacactcaatgaaaccgccagtttttcatctttggttcttgaaacagtcattacataattttagataaatgttactgtccttgaggaggtataccaattatgacagatggacagtaaaatcaatcacgattttagcatgacaaaactcttgaaagcttgatttgattttgatatttgctgttttcagtcaaggcgctgaatcaggcaaggttggaggcgtcggttcgggcttatgggaacggcagtgagaagatcaccaacaaatggccgagcccgtatgttctcctctgcggacttcttctggtcgtgtcgctgttcgagcatttctggcacccgctcaagtggttcgcgctggtggctgcggccgccggcttgccgccgatcgtgctgaggagcattgcggccatccggagactcaccctggatgtcaacatactcatgctgattgctggtaagaacagcctataattcacctgtgacattaatgatgtttcctgttattggtaccttgaaaaaaaaagaagctcccttttgttggaggatggccctgaccatcacctccgacgatcgaagaccctttgatctttaggagataactgaattataaaattttaaataggcttccttcatctggtggcctaatgcatgcattttggcttgtaccaaaacctactttctctctttaatgaaatgaaaagcagaggtcccaccatactttttgaaaagaaatgaacgtttaaatagtatcgaatggtagcaaacacatctgccattaaggatatcctccaattgaatagtctcatttgaaataagaaaacaaattattgacacagcttagtagtagagcattgagttttaacgttgatgccatgggtttgaagcttttttttctgtattaaaagggcaacagtatacttgttcctttttttaccatagtattctcttgtgtgtagaagacacaaatacaacaccactttgggtaaatattcaactacggattgaagttgtgggtattattgatacctgttctaccagtgtgacaatgggttgtgaaaaaaaaagagacaaaagcaagtttcttcacgaggaccaatatggtgggtgattagtgggagagcagaagcagaaatccatctctcaaaagtttatgtctcacttgcataaacttttgctttcttttcttttctagagggtccctcactttccatcacatcaaaaggatatgttgctgtgatgctaatatacgtgctagatgaacaattctgcttcttttcctccatgtggcgatgtcacctcagatagggcatcagattccttttagaacaagcaacatatttcttatcaagaagctacacatatttcgaataattctttctagactaatatcgtggcattgagatagctctattgtgatatgcatatgggaatatgggatacatgaaagaatcatcaaaagaaacaagaaataccttgtttcaaaaagaaaaaaagatttggaagatttggt</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 Ryuichi Takahashi, Yasuhiro Ishimaru, Hugo Shimo, Yuko Ogo, Takeshi Ssnoura, Naoko K. Nishizawa and Hiromi Nakaishi.(2012) The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice. Plant, Cell and Environment 35:1948–1957.
- ↑ 2.0 2.1 2.2 Ryuichi Takahashi, Khurram Bashir, Yasuhiro Ishimaru, Naoko K. Nishizawa and Hiromi Nakanishi.(2012) The role of heavy-metal ATPases, HMAs, in zinc and cadmium transport in rice. Plant Signaling & Behavior 7:12, 1605–1607.
- ↑ 3.0 3.1 Namiko Satoh-Nagasawa, Mikako Mori, Nobushige Nakazawa, Tomohiko Kawamot3, Yasuo Nagato, Kenji Sakurai, Hidekazu Takahashi, Akio Watanabe and Hiromori Akagi.(2012) Mutations in Rice (Oryza sativa) Heavy Metal ATPase2 (OsHMA2) Restrict the Translocation of Zinc and Cadmium. Plant Cell Physiol 53(1): 213–224.
- ↑ Naoki Yamaji, Jixing Xia, Namiki Mitani-Ueno, Kengo Yokosho, and Jian Feng Ma.(2013) Preferential Delivery of Zinc to Developing Tissues in Rice Is Mediated by P-Type Heavy Metal ATPase OsHMA2. Plant Physiology� 162:927–939.
