Difference between revisions of "Os06g0569500"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Gibberellins (GAs) are a group of diterpene-type plant hormones biosynthesized froment-kaurene via ent- kaurenoic acid. GAs are ubiquitously present in seed plants. The GA signal is perceived and transduced by the GID1 GA receptor/DELLA repressor pathway<ref name="ref1" />.All higher plants contain an ent-kaurene oxidase (KO), as such a cytochrome P450 (CYP) 701 family member is required for gibberellin (GA) phytohormone biosynthesis. While gene expansion and functional diversification of GA-biosynthesis-derived diterpene synthases into more specialized metabolism has been demonstrated, no functionally divergent KO/CYP701 homologs have been previously identified. Rice ( ''Oryza sativa'') contains five CYP701A subfamily members in its genome,despite the fact that only one (''OsKO2/CYP701A6'') is required for GA biosynthesis <ref name="ref2" />.Therefore,The Rice dwarf virus (RDV), a member of the genus Phytoreovirus,
 
Gibberellins (GAs) are a group of diterpene-type plant hormones biosynthesized froment-kaurene via ent- kaurenoic acid. GAs are ubiquitously present in seed plants. The GA signal is perceived and transduced by the GID1 GA receptor/DELLA repressor pathway<ref name="ref1" />.All higher plants contain an ent-kaurene oxidase (KO), as such a cytochrome P450 (CYP) 701 family member is required for gibberellin (GA) phytohormone biosynthesis. While gene expansion and functional diversification of GA-biosynthesis-derived diterpene synthases into more specialized metabolism has been demonstrated, no functionally divergent KO/CYP701 homologs have been previously identified. Rice ( ''Oryza sativa'') contains five CYP701A subfamily members in its genome,despite the fact that only one (''OsKO2/CYP701A6'') is required for GA biosynthesis <ref name="ref2" />.Therefore,The Rice dwarf virus (RDV), a member of the genus Phytoreovirus,
causes dwarfed growth phenotypes in infected rice ( Oryza sativa) plants. The outer capsid protein P2 is essential during RDV infection of insects and thus influences transmission of RDV by the insect vector.P2 of RDV interacts with ent-kaurene oxidases, which play a key role in the biosynthesis of plant growth hormones gibberellins, in infected plants. the P2 protein of RDV interferes with the function of a cellular factor, through direct physical interactions, that is important for the biosynthesis of a growth hormone leading to symptom expression.P2 may provide a novel tool to investigate the regulation of GA metabolism for plant growth and development<ref name="ref3" />.
+
causes dwarfed growth phenotypes in infected rice ( Oryza sativa) plants. The outer capsid protein P2 is essential during RDV infection of insects and thus influences transmission of RDV by the insect vector.P2 of RDV interacts with ent-kaurene oxidases, which play a key role in the biosynthesis of plant growth hormones gibberellins, in infected plants. the P2 protein of RDV interferes with the function of a cellular factor, through direct physical interactions, that is important for the biosynthesis of a growth hormone leading to symptom expression.P2 may provide a novel tool to investigate the regulation of GA metabolism for plant growth and development<ref name="ref3" />.GAs are biosyn-thesized from geranylgranyl diphosph ate, which is converted to ent-kaurene by 2 terpene syntheses, ent-copalyl diphosphate synthase, andent-kaurene synthase, in plants.Then ent-kaurene is converted to GA12 by two cytochrome P450 enzymes, ent-kaurene oxidase (KO) and ent-kaurenoic acid oxidase (KAO). KO locates in the outer membrane of the plastid, and KAO locates in the endoplasmic
 +
reticulum<ref name="ref4" />.
  
 
===Expression==
 
===Expression==

Revision as of 11:52, 1 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Gibberellins (GAs) are a group of diterpene-type plant hormones biosynthesized froment-kaurene via ent- kaurenoic acid. GAs are ubiquitously present in seed plants. The GA signal is perceived and transduced by the GID1 GA receptor/DELLA repressor pathway[1].All higher plants contain an ent-kaurene oxidase (KO), as such a cytochrome P450 (CYP) 701 family member is required for gibberellin (GA) phytohormone biosynthesis. While gene expansion and functional diversification of GA-biosynthesis-derived diterpene synthases into more specialized metabolism has been demonstrated, no functionally divergent KO/CYP701 homologs have been previously identified. Rice ( Oryza sativa) contains five CYP701A subfamily members in its genome,despite the fact that only one (OsKO2/CYP701A6) is required for GA biosynthesis [2].Therefore,The Rice dwarf virus (RDV), a member of the genus Phytoreovirus, causes dwarfed growth phenotypes in infected rice ( Oryza sativa) plants. The outer capsid protein P2 is essential during RDV infection of insects and thus influences transmission of RDV by the insect vector.P2 of RDV interacts with ent-kaurene oxidases, which play a key role in the biosynthesis of plant growth hormones gibberellins, in infected plants. the P2 protein of RDV interferes with the function of a cellular factor, through direct physical interactions, that is important for the biosynthesis of a growth hormone leading to symptom expression.P2 may provide a novel tool to investigate the regulation of GA metabolism for plant growth and development[3].GAs are biosyn-thesized from geranylgranyl diphosph ate, which is converted to ent-kaurene by 2 terpene syntheses, ent-copalyl diphosphate synthase, andent-kaurene synthase, in plants.Then ent-kaurene is converted to GA12 by two cytochrome P450 enzymes, ent-kaurene oxidase (KO) and ent-kaurenoic acid oxidase (KAO). KO locates in the outer membrane of the plastid, and KAO locates in the endoplasmic reticulum[4].

=Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0569500

Description

Similar to Ent-kaurene oxidase 1 (Fragment)

Version

NM_001064440.1 GI:115468611 GeneID:4341343

Length

6995 bp

Definition

Oryza sativa Japonica Group Os06g0569500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:22898131..22905125

Sequence Coding Region

22898131..22898642,22898989..22899157,22899243..22899497,22899652..22899792,22899893..22900051
,22901401..22901561,22904990..22905125

Expression

GEO Profiles:Os06g0569500

Genome Context

<gbrowseImage1> name=NC_008399:22898131..22905125 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:22898131..22905125 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagtcgatgctcgtagccggagcgggcgcggcggcggtggcggccgtcgggggcctcgtcgcggcggccgcgctcgccgacaagctcgtcgcggcgccgccgccgcgcaagaaccgcgccaacccgcctccagctgttcctggtttacccattattggaaatctgcatcaattgaaagaaaagaagcctcatcagacgtttgcaaaatggtctgaaacttatggaccaatctacactataaagaccggagcttctccagtggttgtgctcaattcaactgaagtagccaaggaggcgatgattgacaaattctcatccatatctactcgaaagctaccaaaagcaatgtctgtgctaactcgtaaaagtatggtcgcaatcagcgactacggtgactaccaaaagatggcgaagcgtaatattatgattggcatgttaggttttaatgcacagaaacagtttcgcggtacaagagagaggatgatcagtaacgtgttaagcactttgcataagttggtttctcttgacccacattcccctctgaacttcagggatgtttacattaatgagctgttcagcttgtccttgatccagagtttaggtgaggatgtgagttcagtttatgtggaagagtttgggagggagatatccaaggacgaaatctttgatgtccttgtgcatgagatgatgatgtgtgcagttgaggctgactggagggactacttcccctacctcagctggcttccaaacaagagcttcgacacaattgtgtctactacagaattcagacgagatgctatcatgaatgcattgatcaagaagcagaaggagaggattgcacgcggagaggcaagggcatcctacattgacttcttgctggaagctgagaggagtgcacagctgacagatgaccaactgatgctgctgctgtcggagtccatcctggctgcagctgatactgtcctggtgaccaccgaatggaccatgtatgagattgccaagaaccctgacaaacaggagctactctaccaagagatccgagaggcgtgcggcggcgaggcggtgaccgaggacgacttgccgcggctgccgtacctcaacgccgtgttccacgagacgctgcggctgcactccccggtgccggtgctgcccccgaggttcgtccacgacgacaccacgctcgccggctacgacatcgcggcgggcacccagatgatgatcaacgtgtacgcgtgccacatggacgagaaggtgtgggagtcgccgggggagtggtcgccggagaggttcctcggcgaggggttcgaggtggcggacaggtacaagacgatggcgttcggcgccgggaggaggacctgcgcggggagcctgcaggcgatgaacatcgcgtgcgtcgccgtggcgcgcctcgtgcaggagctcgagtggaggctgagggagggcgacggggacaaggaggacaccatgcagttcaccgccttgaagcttgacccgctgcatgtccacctcaagcccagaggaaggatgtga</cdnaseq>

Protein Sequence

<aaseq>MESMLVAGAGAAAVAAVGGLVAAAALADKLVAAPPPRKNRANPP PAVPGLPIIGNLHQLKEKKPHQTFAKWSETYGPIYTIKTGASPVVVLNSTEVAKEAMI DKFSSISTRKLPKAMSVLTRKSMVAISDYGDYQKMAKRNIMIGMLGFNAQKQFRGTRE RMISNVLSTLHKLVSLDPHSPLNFRDVYINELFSLSLIQSLGEDVSSVYVEEFGREIS KDEIFDVLVHEMMMCAVEADWRDYFPYLSWLPNKSFDTIVSTTEFRRDAIMNALIKKQ KERIARGEARASYIDFLLEAERSAQLTDDQLMLLLSESILAAADTVLVTTEWTMYEIA KNPDKQELLYQEIREACGGEAVTEDDLPRLPYLNAVFHETLRLHSPVPVLPPRFVHDD TTLAGYDIAAGTQMMINVYACHMDEKVWESPGEWSPERFLGEGFEVADRYKTMAFGAG RRTCAGSLQAMNIACVAVARLVQELEWRLREGDGDKEDTMQFTALKLDPLHVHLKPRG RM</aaseq>

Gene Sequence

<dnaseqindica>6484..6995#5969..6137#5629..5883#5334..5474#5075..5233#3565..3725#1..136#atggagtcgatgctcgtagccggagcgggcgcggcggcggtggcggccgtcgggggcctcgtcgcggcggccgcgctcgccgacaagctcgtcgcggcgccgccgccgcgcaagaaccgcgccaacccgcctccaggtaattaattaatccagctcgccgtgttcgtttcgatcgatcaaatgatcttctccaattggtttgatcctcactgctgctgtgtctcggtgttcgtcgtactctctccattgattgatctctgttggagatggcagtgtatgtggttagtttgttcgtcggaaaatatgtcgaattttctctgtttcagctagtgcgtaagctttttttttttgatggaatggtaatttctggtgtcgcaacaattagaaatgagcatgaatgatcagtttggcgtagataacaggatttgagctataacagcactcacggctgcgacagcacacctattgtgcacaaacaagtactccgccgttctaaaacataagtattttttttacatgtacacgatctccgagatgatactttaatcaacaatatctacaaaagtaaaatgtcttaaataaaaagagttgcatattatgatagttcgtttaatgataaatataataaaattaaatttacatgattaatcttttttaaaaagtttgacttagcactgttctaaaaatgcttatattttgggacagagggagtaatataaatggaggaggtggttagtggttttggcagatgtaaatatagtataattgtagtgtaattacattgtaacttacatataactacgatataaatttgaaccgttcgatttgctttaaaattcgcaagggatgtaggaaaaaatcacaacccactcacatgtgaggcgattcagtaccattacctccgttttcacataagtagcacatcacctagggatttttgaaaattacatactccctccgagctgatgatattagtcgctttaaataaggataaaatcaaaccttaaaatctttgactataaataatttctaaaatatttatcttaaaaaatgaaaaccatatatatatatatatatatatatatatatatatattagtcttaaaaagtacttcaataaaatcatatatttgttgatatttctatatatattataatagaaaatagttatcaaagctactctttggagactgtgcccttgtccaaaacgacaaatattattaacctggagggagtacaagttaaactatagttacatgtaagttacgttgtaattacatcacggtatttacacctatcaaattttttagcgaaaatttaacgacaaatgtatagctaatcccttaattttgatatattgcttgaaaatcgaattttccgaacagcaatttgtcgcgatggaccatataggaattaaagtggataatccaaatccactagattttattgaaactatatatcctaatcctaatactaatccgttggattttgaaaaaatacttaccatatctccgttcgattggattcagaacggatcagattgaaaagtgttaaatcatttttcatccttttttttttgagaaatcctttttttttctgtagtcctcggttcagttttgactgaatgtctgaaagggatgttgtttaattaacttgaaacagttcaaaattacaagcattcatgtctctgtcagttgaagtagccttctccttctcttctatatgttcgtcagactacttcagaaagtaggtacttcctctagtcacgaatatgttactgagaggctataactaaaaacacagtacctctgatttgtaatagataatgcccttaacatttgaaaatatgtttactcatccatcttatttatagaatttatataattattatttattttttgagttattttattattagaaatattttaagcataattcatatcttattcacttacccaaaatttttaaataagacgaatagtcaaacgtgtatcaaaaattaactgagccggagagaggatatctgaaactatgaaaagaggagcaattaaccatttcttccttaatccgcctgcatgcaacttgaaatcacaaaagcaaactcaagtcaatgccatggggaaaatttacagtagcccctgcttgcaggtaccaaaagaaaattgatcaatttcatgcaggtgtgaccaaagtactggattccaggcatagcacaagaacattccacggaagtaccacagcaaactcaatcaatcgttttacttggtccaaaagaattaagaaaactgtgcacctcttaacccattctaatgatgaggatccatttcctaattaaaggactttgttgtcaatcaattagactatattaataaagatgagccatttattttatcttttttttttttgaaaaatgttgaccagagaagagaaacatcccaaaggcattgccatcttacctgtatacggactctgttgccaccgttcttaaaaacttttaaaatgattttcattttctacggaaaagagtattaatgtagaatagtaaaaaaaatcattatcagtatttccgacggtggcggggagttatataatatatatttatgatgaattgtattcccctgcttttgttgaaacaaagtgttctttcaatatctcattcactattcatttgacttatatggattttaaaaataggcaatttatatgccataccgttatccattctgagcatggactaaatatttagaacgtaaattttgaacagactaaccttttagtgtgccggaactattaaaaaaaattaaagacttttattaatccataaaatatgtccgaaaatgtgttcttcagtttgttttcttctggttaagtatgcactggttctagttggcacatgtataatagttgtgattgcatatctattttgctgattaagagtaaacaaatggaaataactttctttgagttacgctttcagttaagattgttttgaaattattaatgtgcaaaatgaaagtagttattatagatcctttcagatatgtctatttcgatgagccactagtgcctgtgttgaaaatgcaaattattctagacaaattttgctagaggactttgtgacttcgtgattttagctgtatgacactgcacgaagtaactttgggggacaacactctataaacgtgaaaattgactcgtcgacaccgcttctattagaatattcattccaggttgaatatgagagtgaaatcatgtgaaagttctgaaatgcctctgagcctacatgtgaggtctaccatctctctatcactggccaaaatttcatcagatatttttagcttatttgattgtgtttactccatctgtccatcatctatccatgtacatagctagcattcttactgaaaaatgacccaataaaaggaaatatagaacctgtacatgttaaattacttgcttgaatgtttggtgttttcatttatgcagagacgaattaccaaaaacaaattaatttcagtccactacaagagctttagtaataacatcgttagttattgtaatgcagctgttcctggtttacccattattggaaatctgcatcaattgaaagaaaagaagcctcatcagacgtttgcaaaatggtctgaaacttatggaccaatctacactataaagaccggagcttctccagtggttgtgctcaattcaactgaagtagccaaggaggtatgcaagttgtcctttttcagcatttttttgttacctgttaatgttttcattttctttccgactacccaaattggtgtccccatatactctccactcttttacccacacttttcattcactgatatcctggactagcaccacaatttgctcgagctaagggtgctggtggtccatctttgttaggaaataaaataaaattatcatgactgttgcatcaagcaatgcatgtattcttacataattgtaactctggtgaccgcatactgttataaaatcaacctatccgacattacaactccaagtcttaaattataaccgactttatacacatattcgacacaaactctaacaaataaagtaataactaattcaatagaaacaaacatagacttatatggttcaaaatttaatcttagttttccccttttttttcaaaattttcacttaatctatctttagactcttttgaatttctattcaaacagataaaactctgaagagcaaggaattcaaaagagtacaaatatgtgatgtttttttttttaaaaaagatgaattcaaactgatgaaatttagaataaataggcaaggtttcagattgatcaactcgaaaaaaattgctctaaaatgctaaaacacgaatgaaggggtagttaaggacaaggaagcacacgtggttacagttgtaccattgtttttacgcttttcaaattatccttacacatgcaaaatagaggtgcttttagtatgatgtgtatgtaaattgcatggttttgacaatttcaaatgctatcctatccggttacttagtttacagttgatttttttacttgtgcaaaagtttagaattgtaagtggacatttctcttgataaattaaatgtgaatatcataattacaattaattcagatcagaaatgaaattaacctacaacatgaactctagagctaatatgatattattttttgtttctcttttttcgtggaggtaaaactgtaaacgctttggttcatgcaattgtgctatgatgttggcttctagttcatgacatgggtcctatgatgtttgatatgttttatcttccttattattcttggcttcaaggttgacatgtttgtatatgtttgtgcaaataccttgtttggaaagaaaataaaggcaatgtaaggaataacatcccaaagacttgaactctgtttgatcttcaatatatctaagtcttcaaaaaagaacttttatactacttttttcttactcttgcatagttacatatactcaataatgataatctcatattaattggtctgtaaataacaaaaacacatattctgtactactttttccaggcgatgattgacaaattctcatccatatctactcgaaagctaccaaaagcaatgtctgtgctaactcgtaaaagtatggtcgcaatcagcgactacggtgactaccaaaagatggcgaagcgtaatattatgattggcatgttaggttttaatgcacaggtacaaatctcagcaaaatttaaattcaatagtggattttgggtaccattagcactcagttaattgagctctaacaatgaaatgcttgcataaatttcagaaacagtttcgcggtacaagagagaggatgatcagtaacgtgttaagcactttgcataagttggtttctcttgacccacattcccctctgaacttcagggatgtttacattaatgagctgttcagcttgtccttgatccaggtttgtattacctctgaacttgaactctccagtggtccgtttgttacttccaatacctgtcatgattgttatgaacttataattgttgcaatttcgtagttactaggactgatcttgattgttatgaacttatatatatttgttacaatttcagagtttaggtgaggatgtgagttcagtttatgtggaagagtttgggagggagatatccaaggacgaaatctttgatgtccttgtgcatgagatgatgatgtgtgcagttgaggctgactggagggactacttcccctacctcagctggcttccaaacaagagcttcgacacaattgtgtctactacagaattcagacgagatgctatcatgaatgcattgatcaagaagcagaaggagaggattgcacgcggagaggtgacacaaaacttctattcgtatccaaaaataactttttttttctgcagatcatctgaactgaactgtaacgtattgcatgcaggcaagggcatcctacattgacttcttgctggaagctgagaggagtgcacagctgacagatgaccaactgatgctgctgctgtcggagtccatcctggctgcagctgatactgtcctggtgaccaccgaatggaccatgtatgagattgccaagaaccctgacaaacaggcaagaaattaactgatactacctccagttttattttttggtttcggacaacacatgttttagcatgttttctttgtaacttgtcgtaaacgtcaattaattttgtccggagggagtactttcaattatcttttgtatatactctttcttgtattgtattgtgatcctctgacataactttctcttgatatggtcattgacatgtcagcgatcatgtctctataactttacgagaaagaaagtcagaggatctcaatccctctttctttcaaatgcatttcagcattttgttgccaaccaaactaataaacaattgattgtttcttgttcttggcacatcgatcaggagctactctaccaagagatccgagaggcgtgcggcggcgaggcggtgaccgaggacgacttgccgcggctgccgtacctcaacgccgtgttccacgagacgctgcggctgcactccccggtgccggtgctgcccccgaggttcgtccacgacgacaccacgctcgccggctacgacatcgcggcgggcacccagatgatgatcaacgtgtacgcgtgccacatggacgagaaggtgtgggagtcgccgggggagtggtcgccggagaggttcctcggcgaggggttcgaggtggcggacaggtacaagacgatggcgttcggcgccgggaggaggacctgcgcggggagcctgcaggcgatgaacatcgcgtgcgtcgccgtggcgcgcctcgtgcaggagctcgagtggaggctgagggagggcgacggggacaaggaggacaccatgcagttcaccgccttgaagcttgacccgctgcatgtccacctcaagcccagaggaaggatgtga</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0569500, RefSeq:Os06g0569500

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4